Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cla02g01497 ATGGCGTCGAGGAACCGGACTTTGCTTTTTAGGAAATACAGGGACGCGTTGAGGAGTGTGAGGGTTCCTACCAGCTCGTCGCCTGTTTCTGCATCGCCATCGACTAGCTCTGCCGCTGGTGGCCCGGTGATTGAATTGGTTAGCTCGTCGTTGTTGAATCCCAATCGGTCGTACGCTCCATTAAGTACTGAGGATCCGGGTAATTCAAGTAAGGGTGCTCTTACCGTTGGTCTACCTCCGGCTTGGGTGGATGTATCTGAAGAAATAGCTGCAAATGTGCAGCGTGCACGAGTGAAGATGGTGGAGTTAGCTAAGGCTCATGCAAAGGCTTTAATGCCTTCATTTGGAGATGGTAAAGAGGATCAACGATTAATTGAATCTCTCACACAAGACATAACCAATTTAATCAAGAAATCAGAGAAAGGACTCAAGAGACTCTCTGTAGCCGGACCTTCAGAAGATTCCAATATCAGAAAAAATGTTCAGCGATCTCTTGCCACTGATCTTCAGAACCTTTCCATGGAGCTTCGCAAGAAACAATCAACATATTTAAAGCGGCTACGGCAGCAAAAAGAGGAAGGTCAAGATGGGATTGACATAGAGATGAATCTAAATGGAAATAGATCGAGAATGGAGGACGATGATTTAGAACATATGGTGTTTAATGAGCATCAGATGGCTAAGCTGCGAAAGAGTGAAGCATTCACCGCCGAAAGAGAGAGAGAGATCCAACAAGTTGTAGAATCCGTGAATGAGCTTGCTCAGATCATGAAGGATCTATCTGTACTTGTCATAGACCAGGGTACCATTATCGATAGAATAGATTACAATATTCAAAATGTTGCAACGACCGTCGATGAGGGCCTTAAGCAACTGCAAAAGGCAGAGAGAACACAGAAACAAGGAGGGATGGTGATGTGCGCATCCGTGCTCATTATCATGTGCTTTGTCATGTTGGTTCTTCTGATCCTCAAAACCATACTATTTTAA 990 44.55 MASRNRTLLFRKYRDALRSVRVPTSSSPVSASPSTSSAAGGPVIELVSSSLLNPNRSYAPLSTEDPGNSSKGALTVGLPPAWVDVSEEIAANVQRARVKMVELAKAHAKALMPSFGDGKEDQRLIESLTQDITNLIKKSEKGLKRLSVAGPSEDSNIRKNVQRSLATDLQNLSMELRKKQSTYLKRLRQQKEEGQDGIDIEMNLNGNRSRMEDDDLEHMVFNEHQMAKLRKSEAFTAEREREIQQVVESVNELAQIMKDLSVLVIDQGTIIDRIDYNIQNVATTVDEGLKQLQKAERTQKQGGMVMCASVLIIMCFVMLVLLILKTILF 329
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 29482666 29486894 - ClCG02G015160.1 Cla02g01497 267623

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cla02g01497 329 SMART tSNARE_6 228 295 IPR000727 -
Cla02g01497 329 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 233 295 IPR000727 -
Cla02g01497 329 Pfam SNARE domain 269 321 IPR000727 -
Cla02g01497 329 SMART SynN_4 73 188 IPR006011 GO:0016020
Cla02g01497 329 PANTHER SYNTAXIN 1 324 IPR045242 -
Cla02g01497 329 CDD SNARE_syntaxin16 237 294 - -
Cla02g01497 329 SUPERFAMILY t-snare proteins 78 288 IPR010989 GO:0016020|GO:0016192
Cla02g01497 329 ProSitePatterns Syntaxin / epimorphin family signature. 239 278 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cla02g01497 329 Gene3D - 79 287 - -
Cla02g01497 329 PANTHER TARGET SNARE COILED-COIL-LIKE DOMAIN-CONTAINING PROTEIN-RELATED 1 324 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cla02g01497 K08489 STX16; syntaxin 16 - csv:101207998 580.096
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cla02g01497 Cla-Chr2:29482666 Cla09g00505 Cla-Chr9:4769104 1.41E-132 dispersed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi14g133 . . . . . . . . . . Cma05g01087 Cma12g01045 Car05g00958 Car12g01004 . Cpe07g00878 Cpe11g00890 . . . . . . . Cla02g01497 Cam02g1577 Cec02g1601 Cco02g1642 Clacu02g1560 Cmu02g1513 Cre02g1836 Cone10ag0804 Cone3ag0826 . . . Csa02g00478 . Cme05g01576 . . Bda01g01638 . . . . Bma05g00265 Sed11g0396 Cmo05g01102 Cmo12g01056 . . . . . . Bhi06g01461 Tan08g0631 Cmetu05g1168 . Hepe08g2281 . . . . . . . . . Lsi11g00612 . Chy05g01060 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cla08g01285 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 6.7e-102 367.9
Cla04g00533 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 3.7e-101 365.2
Cla01g01917 . 411 714 SNARE and Associated Proteins AT2G18260 54.7 1.9e-86 316.2
Cla10g01736 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 411.8
Cla01g01480 . 26 282 SNARE and Associated Proteins AT3G11820 72.8 9.0e-103 370.5
Cla03g00522 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.1e-92 337.0
Cla10g01288 . 573 827 SNARE and Associated Proteins AT3G11820 52.5 5.0e-69 258.5
Cla10g01736 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.9e-92 334.7
Cla01g01480 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.4e-85 312.8
Cla03g00522 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.6e-81 298.9
Cla10g01288 . 575 827 SNARE and Associated Proteins AT3G52400 50.6 5.4e-61 231.9
Cla03g00522 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 3.1e-108 388.7
Cla10g01736 . 1 284 SNARE and Associated Proteins AT4G03330 57.2 3.1e-84 308.9
Cla01g01480 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 3.9e-79 292.0
Cla10g01288 . 564 827 SNARE and Associated Proteins AT4G03330 53.8 1.2e-67 253.8
Cla03g00522 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 1.0e-127 453.4
Cla10g01736 . 1 284 SNARE and Associated Proteins AT1G61290 62.0 2.6e-91 332.4
Cla01g01480 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.6e-85 313.2
Cla10g01288 . 579 827 SNARE and Associated Proteins AT1G61290 50.6 1.9e-62 236.5
Cla03g00522 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.8e-124 442.6
Cla10g01736 . 1 284 SNARE and Associated Proteins AT1G11250 62.0 1.6e-93 339.7
Cla01g01480 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 1.1e-86 317.0
Cla10g01288 . 563 827 SNARE and Associated Proteins AT1G11250 50.6 4.9e-66 248.4
Cla10g01288 . 548 846 SNARE and Associated Proteins AT3G03800 73.6 6.0e-112 401.0
Cla10g01288 . 548 745 SNARE and Associated Proteins AT5G08080 78.4 2.4e-78 288.9
Cla10g00138 . 48 319 SNARE and Associated Proteins AT5G16830 56.5 5.0e-73 271.6
Cla10g00138 . 48 319 SNARE and Associated Proteins AT5G46860 62.1 4.2e-77 285.0
Cla10g00138 . 48 237 SNARE and Associated Proteins AT4G17730 76.4 1.8e-72 269.6
Cla10g00138 . 112 319 SNARE and Associated Proteins AT1G32270 54.8 4.3e-50 195.7
Cla07g00385 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 3.3e-111 398.7
Cla08g01285 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 6.7e-102 367.9
Cla02g01497 . 1 327 SNARE and Associated Proteins AT5G26980 76.8 4.8e-128 454.5
Cla09g00505 . 1 356 SNARE and Associated Proteins AT5G26980 59.2 1.3e-96 350.1
Cla02g01497 . 1 329 SNARE and Associated Proteins AT4G02195 64.4 3.4e-105 378.6
Cla09g00505 . 1 356 SNARE and Associated Proteins AT4G02195 59.7 5.6e-100 361.3
Cla02g01497 . 1 328 SNARE and Associated Proteins AT3G05710 76.3 4.1e-130 461.5
Cla09g00505 . 1 356 SNARE and Associated Proteins AT3G05710 57.1 5.2e-93 338.2
Cla09g01036 . 86 310 SNARE and Associated Proteins AT1G16240 69.5 5.8e-83 304.3
Cla10g00459 . 19 243 SNARE and Associated Proteins AT1G16240 65.7 3.7e-77 285.0
Cla09g01036 . 85 310 SNARE and Associated Proteins AT1G79590 68.8 1.9e-82 302.8
Cla10g00459 . 19 243 SNARE and Associated Proteins AT1G79590 66.1 9.9e-79 290.4
Cla06g00045 . 170 315 SNARE and Associated Proteins AT1G28490 69.9 9.6e-50 193.7
Cla10g01938 . 118 381 SNARE and Associated Proteins AT3G09740 79.7 2.8e-113 405.2
Cla02g02052 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 9.9e-95 343.6
Cla02g02052 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.9e-92 334.0
Cla10g01938 . 118 381 SNARE and Associated Proteins AT3G45280 64.4 9.0e-88 320.5
Cla10g01938 . 118 378 SNARE and Associated Proteins AT3G61450 68.2 7.5e-95 344.0
Cla02g02052 . 1 262 SNARE and Associated Proteins AT3G61450 61.0 2.0e-84 309.3
Cla11g00615 . 65 272 SNARE and Associated Proteins AT1G51740 69.0 9.2e-71 263.8
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003497 3 1 2 2 1 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 4 4 2 46
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cla02g01497 Cla_Chr02 FPKM 3.376068 5.874521 0.675765 1.431678 3.225066 3.122738 4.278554 0.0 0.0 0.0