Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cla02g02052 ATGACCGTAATCGACATCATCTTCCGAGTCGATTCCATTTGCAAGAAATATGAGAAGTATGATGTCGAGAAACAGCGTGAACTCAATGCTTATGGTGACGATGCCTTTGCTCGCCTCTTCGCCGCCGTCGAACTCGAAATCGACGCCGCTCTCCAGAAATCTGAGGCTGCCTCAACTGAGAAGAATAGAGCTGCTGCAGTTGCAATGAACGCTGAGGTTCGACGGAAGAAGGCTCGATTGATGGATGAAGTCCCTAAGCTTCGTAAATTGGCTCATAAGAAGGTTAAAGGGGTTCCGAAAGAAGAGCCGGAGGTTAGAGATGATCTTGTTCTTGCGCTTGAAGAGAAGATTAAAGCCATACCAGATGGGAGTACCTCAGGAGCCAAACAATCTGGAGGATGGGGGTCCTCCTCCTCATCTAACAATATCAAGTTTGATTCATCAGATGGAAACTTTGAGAGCGAGTATTTCCAGCAAAGTGAAGAATCAAGCCAATTTCGAAATGAGTATGAAATGCGGAAGATGAAACAGGACCAAGGTCTCGATGTCATATCTGAAGGTTTGGATATGCTGAAAAATCTAGCCCATGATATGAATGAGGAATTGGACAGGCAAGTTCCATTAATCGACGAGATCGACGCAAAGGTAGACAAGGTGACTGATGAGATTAAAAATACCAATGTTAGGCTCAAGGAAACGCTCTATGAGGTGAGATCCAGCCAAAACTTCTGCATTGATATTATTCTTCTCTGTATAATTCTTGGAATTGCTTCTTACTTGTACAATATCTTGAGCTGA 798 43.73 MTVIDIIFRVDSICKKYEKYDVEKQRELNAYGDDAFARLFAAVELEIDAALQKSEAASTEKNRAAAVAMNAEVRRKKARLMDEVPKLRKLAHKKVKGVPKEEPEVRDDLVLALEEKIKAIPDGSTSGAKQSGGWGSSSSSNNIKFDSSDGNFESEYFQQSEESSQFRNEYEMRKMKQDQGLDVISEGLDMLKNLAHDMNEELDRQVPLIDEIDAKVDKVTDEIKNTNVRLKETLYEVRSSQNFCIDIILLCIILGIASYLYNILS 265
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 35582092 35585001 + ClCG02G021070.2 Cla02g02052 268178

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cla02g02052 265 ProSitePatterns Syntaxin / epimorphin family signature. 177 216 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cla02g02052 265 PANTHER SYNTAXIN 1 262 IPR045242 -
Cla02g02052 265 Pfam SNARE domain 208 257 IPR000727 -
Cla02g02052 265 SMART tSNARE_6 166 233 IPR000727 -
Cla02g02052 265 Gene3D - 171 232 - -
Cla02g02052 265 MobiDBLite consensus disorder prediction 124 145 - -
Cla02g02052 265 SUPERFAMILY SNARE fusion complex 167 231 - -
Cla02g02052 265 Coils Coil 209 229 - -
Cla02g02052 265 CDD SNARE_Qc 176 232 - -
Cla02g02052 265 PANTHER SYNTAXIN-72 1 262 - -
Cla02g02052 265 MobiDBLite consensus disorder prediction 122 145 - -
Cla02g02052 265 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 171 233 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cla02g02052 K08506 SYP7; syntaxin of plants SYP7 - csv:101211289 441.039
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cla10g01938 Cla-Chr10:35222601 Cla02g02052 Cla-Chr2:35582092 9.71E-118 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi6g289 . . Bda02g00767 . Bpe01g00179 . . . . . . . . . . Cpe05g00828 . . . . . . . . Cla02g02052 Cam02g2177 Cec02g2216 Cco02g2256 Clacu02g2162 Cmu02g2099 Cre02g2412 . Cone5ag1222 . . . . . Cme11g01789 . Blo14g00167 . . . . . Bma11g00164 Sed05g2859 Cmo02g00885 Cmo20g00513 Cma02g00885 . . Car20g00420 . . Bhi10g00561 Tan05g0265 Cmetu11g0284 . Hepe08g0878 . . . . . . . . . . . . .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cla08g01285 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 6.7e-102 367.9
Cla04g00533 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 3.7e-101 365.2
Cla01g01917 . 411 714 SNARE and Associated Proteins AT2G18260 54.7 1.9e-86 316.2
Cla10g01736 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.5e-115 411.8
Cla01g01480 . 26 282 SNARE and Associated Proteins AT3G11820 72.8 9.0e-103 370.5
Cla03g00522 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.1e-92 337.0
Cla10g01288 . 573 827 SNARE and Associated Proteins AT3G11820 52.5 5.0e-69 258.5
Cla10g01736 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.9e-92 334.7
Cla01g01480 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.4e-85 312.8
Cla03g00522 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.6e-81 298.9
Cla10g01288 . 575 827 SNARE and Associated Proteins AT3G52400 50.6 5.4e-61 231.9
Cla03g00522 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 3.1e-108 388.7
Cla10g01736 . 1 284 SNARE and Associated Proteins AT4G03330 57.2 3.1e-84 308.9
Cla01g01480 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 3.9e-79 292.0
Cla10g01288 . 564 827 SNARE and Associated Proteins AT4G03330 53.8 1.2e-67 253.8
Cla03g00522 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 1.0e-127 453.4
Cla10g01736 . 1 284 SNARE and Associated Proteins AT1G61290 62.0 2.6e-91 332.4
Cla01g01480 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.6e-85 313.2
Cla10g01288 . 579 827 SNARE and Associated Proteins AT1G61290 50.6 1.9e-62 236.5
Cla03g00522 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.8e-124 442.6
Cla10g01736 . 1 284 SNARE and Associated Proteins AT1G11250 62.0 1.6e-93 339.7
Cla01g01480 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 1.1e-86 317.0
Cla10g01288 . 563 827 SNARE and Associated Proteins AT1G11250 50.6 4.9e-66 248.4
Cla10g01288 . 548 846 SNARE and Associated Proteins AT3G03800 73.6 6.0e-112 401.0
Cla10g01288 . 548 745 SNARE and Associated Proteins AT5G08080 78.4 2.4e-78 288.9
Cla10g00138 . 48 319 SNARE and Associated Proteins AT5G16830 56.5 5.0e-73 271.6
Cla10g00138 . 48 319 SNARE and Associated Proteins AT5G46860 62.1 4.2e-77 285.0
Cla10g00138 . 48 237 SNARE and Associated Proteins AT4G17730 76.4 1.8e-72 269.6
Cla10g00138 . 112 319 SNARE and Associated Proteins AT1G32270 54.8 4.3e-50 195.7
Cla07g00385 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 3.3e-111 398.7
Cla08g01285 . 8 338 SNARE and Associated Proteins AT3G24350 64.8 6.7e-102 367.9
Cla02g01497 . 1 327 SNARE and Associated Proteins AT5G26980 76.8 4.8e-128 454.5
Cla09g00505 . 1 356 SNARE and Associated Proteins AT5G26980 59.2 1.3e-96 350.1
Cla02g01497 . 1 329 SNARE and Associated Proteins AT4G02195 64.4 3.4e-105 378.6
Cla09g00505 . 1 356 SNARE and Associated Proteins AT4G02195 59.7 5.6e-100 361.3
Cla02g01497 . 1 328 SNARE and Associated Proteins AT3G05710 76.3 4.1e-130 461.5
Cla09g00505 . 1 356 SNARE and Associated Proteins AT3G05710 57.1 5.2e-93 338.2
Cla09g01036 . 86 310 SNARE and Associated Proteins AT1G16240 69.5 5.8e-83 304.3
Cla10g00459 . 19 243 SNARE and Associated Proteins AT1G16240 65.7 3.7e-77 285.0
Cla09g01036 . 85 310 SNARE and Associated Proteins AT1G79590 68.8 1.9e-82 302.8
Cla10g00459 . 19 243 SNARE and Associated Proteins AT1G79590 66.1 9.9e-79 290.4
Cla06g00045 . 170 315 SNARE and Associated Proteins AT1G28490 69.9 9.6e-50 193.7
Cla10g01938 . 118 381 SNARE and Associated Proteins AT3G09740 79.7 2.8e-113 405.2
Cla02g02052 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 9.9e-95 343.6
Cla02g02052 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.9e-92 334.0
Cla10g01938 . 118 381 SNARE and Associated Proteins AT3G45280 64.4 9.0e-88 320.5
Cla10g01938 . 118 378 SNARE and Associated Proteins AT3G61450 68.2 7.5e-95 344.0
Cla02g02052 . 1 262 SNARE and Associated Proteins AT3G61450 61.0 2.0e-84 309.3
Cla11g00615 . 65 272 SNARE and Associated Proteins AT1G51740 69.0 9.2e-71 263.8
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63