Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cla04g00684 ATGTCCATGAAAACACAAGTAGTAGCTTCAGATTGGATTTTTCTTCAACTTGGAGATCATTCTGTTTCCAGTCAACTTGAAAACAGAAACTGCTTTCATCTTCTACTCAGCACCACAGAATATGATGAGAACAGCTTTGGATCGATACCTGCTTTTCGAGTTTCATCAACATTTGTAGTAACCTTGCTGATGTTGTTCATGATCTGCAAGAAAAAAAATCCACTGATTCGAAAATCTCTTAACGCCAATTTCAATCTCTGGAACTTTCAAACCATGGCCACAAGCGTCTCGCACTCTCCCGATTTCCGCCCTGAAGTTTCAGTTCCGCCGCCGACCCATGACGGCCTTTACTTCTGGCAGTTCATGATCGCCGGGTCAATTGCAGGGTCGGTCGAGCACATGGCGATGTATCCAGTGGACACTCTCAAGACCCGAATACAAGCCCTCGGCGGCGGATCGTCAACAGTCCGACAAGCACTCGGCTCGATTCTGAAGGTGGAAGGTCCGGCAGGACTCTACCGTGGAATCGGAGCAATGGGTTTGGGAGCAGGACCTGCACACGCAGTCTATTTCTCAGTGTATGAGTTTTGCAAAGAAGGGTTTTCAATGGGAAATAACAACAACCCATTAGCGCACGCCATTGCTGGAGTTTGTGCGACGGTGACGAGCGACGCGGTGATAACGCCGATGGATGTGGTGAAACAGAGGCTGCAGTTGATGAGCAGTCCTTATAAAGGGGTGGGAGAGTGTGTGAGGAGGATTTTGGTTGAGGAAGGAATTGGGGCGCTGTATGCCTCTTATCGGACGACGGTTGTGATGAACGCACCGTATACGGCGGTGTATTTTGCGACTTATGAAGCTGCAAAAAGGGGATTGAAGGAGGTTTCACTGGGAAGTGACAACGATGAGAGGCTGATTGTTCATGCTACGGCTGGTGCGGCAGCTGGGTCTCTTGCTGCTGCTCTTACAACGCCATTAGACGTTGTGAAAACTCGGCTGCAGTGCCAGGGAGTATGTGGTTGCGACAAATTTTCAAGCAGTTCAATTGGGTACGTACTTGGTTGTGTAGTGAAGAAAGACGGCTACAGTGGGCTGATGAAGGGATGGATTCCAAGGATGATGTTCCATGCCCCTGCTGCTGCAATTTGCTGGTCCACTTATGAGGCTTCAAAAACCTTCTTTCAACATCTCCACAACGATAACAATTAG 1209 48.55 MSMKTQVVASDWIFLQLGDHSVSSQLENRNCFHLLLSTTEYDENSFGSIPAFRVSSTFVVTLLMLFMICKKKNPLIRKSLNANFNLWNFQTMATSVSHSPDFRPEVSVPPPTHDGLYFWQFMIAGSIAGSVEHMAMYPVDTLKTRIQALGGGSSTVRQALGSILKVEGPAGLYRGIGAMGLGAGPAHAVYFSVYEFCKEGFSMGNNNNPLAHAIAGVCATVTSDAVITPMDVVKQRLQLMSSPYKGVGECVRRILVEEGIGALYASYRTTVVMNAPYTAVYFATYEAAKRGLKEVSLGSDNDERLIVHATAGAAAGSLAAALTTPLDVVKTRLQCQGVCGCDKFSSSSIGYVLGCVVKKDGYSGLMKGWIPRMMFHAPAAAICWSTYEASKTFFQHLHNDNN 402
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
4 21617124 21620633 - ClCG04G006760.2 Cla04g00684 270912

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cla04g00684 402 ProSiteProfiles Solute carrier (Solcar) repeat profile. 116 200 IPR018108 -
Cla04g00684 402 PANTHER MITOFERRIN-LIKE 93 401 - -
Cla04g00684 402 ProSiteProfiles Solute carrier (Solcar) repeat profile. 207 291 IPR018108 -
Cla04g00684 402 PANTHER MITOFERRIN-1-RELATED 93 401 - -
Cla04g00684 402 SUPERFAMILY Mitochondrial carrier 114 388 IPR023395 -
Cla04g00684 402 PRINTS Mitochondrial carrier protein signature 222 240 IPR002067 GO:0055085
Cla04g00684 402 PRINTS Mitochondrial carrier protein signature 312 334 IPR002067 GO:0055085
Cla04g00684 402 PRINTS Mitochondrial carrier protein signature 134 148 IPR002067 GO:0055085
Cla04g00684 402 PRINTS Mitochondrial carrier protein signature 264 282 IPR002067 GO:0055085
Cla04g00684 402 PRINTS Mitochondrial carrier protein signature 121 134 IPR002067 GO:0055085
Cla04g00684 402 ProSiteProfiles Solute carrier (Solcar) repeat profile. 303 393 IPR018108 -
Cla04g00684 402 Gene3D Mitochondrial carrier domain 202 402 IPR023395 -
Cla04g00684 402 Pfam Mitochondrial carrier protein 208 293 IPR018108 -
Cla04g00684 402 Pfam Mitochondrial carrier protein 117 202 IPR018108 -
Cla04g00684 402 Pfam Mitochondrial carrier protein 304 396 IPR018108 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cla04g00684 K15113 SLC25A28_37, MFRN; solute carrier family 25 (mitochondrial iron transporter), member 28/37 - csv:101210464 592.038
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cla02g01883 Cla-Chr2:34027113 Cla04g00684 Cla-Chr4:21617124 9.60E-151 dispersed
Cla04g00684 Cla-Chr4:21617124 Cla02g02228 Cla-Chr2:37417896 1.34E-30 dispersed
Cla11g00459 Cla-Chr11:5202512 Cla04g00684 Cla-Chr4:21617124 1.90E-09 dispersed
Cla04g00684 Cla-Chr4:21617124 Cla08g00747 Cla-Chr8:19756856 1.38E-39 transposed
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g316 . . . . . . . . . . Cma03g00330 Cma07g01076 Car03g00292 Car07g01060 Sed03g2513 . . Bhi03g02177 Tan03g0759 Cmetu08g1077 . Hepe04g0728 . . Cla04g00684 Cam04g0686 Cec04g0807 Cco04g0860 Clacu04g0732 Cmu04g0726 Cre04g0775 . . . . Lsi01g01574 Csa04g01643 Chy08g00612 . . . . . . . . . . Cmo03g00342 Cmo07g01125 . . . . . Cpe19g00268 . . . . . . . . . . . . . . . . . Cme08g02177
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cla03g00157 . 187 629 Chloroplast and Mitochondria Gene Families AT2G28800 59.0 4.8e-131 464.9
Cla08g01713 . 72 352 Chloroplast and Mitochondria Gene Families AT2G28800 54.5 5.2e-77 285.4
Cla08g00704 . 3 249 Chloroplast and Mitochondria Gene Families AT1G15820 81.9 5.2e-117 417.5
Cla02g00280 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 1.1e-142 503.1
Cla02g01804 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 6.9e-121 430.6
Cla01g02379 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 3.4e-120 428.3
Cla01g02380 . 46 309 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.9e-119 425.2
Cla10g01121 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 78.0 6.5e-119 424.1
Cla10g00607 . 5 266 Chloroplast and Mitochondria Gene Families AT3G27690 66.9 1.2e-96 350.1
Cla11g01861 . 113 329 Chloroplast and Mitochondria Gene Families AT3G27690 51.2 1.1e-52 204.1
Cla08g00194 . 118 321 Chloroplast and Mitochondria Gene Families AT3G27690 53.8 6.8e-52 201.4
Cla11g01337 . 3 268 Chloroplast and Mitochondria Gene Families AT3G61470 80.9 1.3e-128 456.1
Cla03g01434 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 65.5 2.8e-86 315.5
Cla06g01586 CCT,ECH 368 595 Chloroplast and Mitochondria Gene Families AT3G61470 50.8 8.7e-64 240.7
Cla09g02009 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 5.9e-90 327.4
Cla04g00716 . 105 382 Chloroplast and Mitochondria Gene Families AT3G08940 82.1 7.6e-133 470.3
Cla10g02086 . 76 333 Chloroplast and Mitochondria Gene Families AT3G08940 81.3 1.1e-118 423.3
Cla11g01861 . 48 336 Chloroplast and Mitochondria Gene Families AT1G76570 79.2 4.6e-142 501.1
Cla03g01160 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.8 8.2e-137 483.4
Cla02g00280 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 3.0e-144 508.1
Cla01g02379 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 1.0e-120 429.9
Cla01g02380 . 49 309 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 5.2e-120 427.6
Cla02g01804 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 6.8e-120 427.2
Cla10g01121 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 84.5 1.7e-118 422.5
Cla10g00607 . 7 266 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 3.6e-97 351.7
Cla03g00652 . 27 256 Chloroplast and Mitochondria Gene Families AT2G05070 50.4 2.1e-52 203.0
Cla08g00194 . 118 321 Chloroplast and Mitochondria Gene Families AT2G05070 54.3 4.6e-52 201.8
Cla11g01861 . 113 329 Chloroplast and Mitochondria Gene Families AT2G05070 50.2 3.0e-51 199.1
Cla02g00280 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.7e-125 446.0
Cla01g02379 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.8e-102 367.9
Cla01g02380 . 49 281 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 1.7e-101 366.3
Cla02g01804 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.0e-101 364.8
Cla10g01121 . 27 237 Chloroplast and Mitochondria Gene Families AT2G05100 83.4 1.9e-100 362.8
Cla10g00607 . 7 238 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 5.1e-82 301.6
Cla08g00194 . 118 305 Chloroplast and Mitochondria Gene Families AT2G05100 53.1 1.6e-43 173.7
Cla04g00716 . 105 264 Chloroplast and Mitochondria Gene Families AT2G40100 72.0 9.7e-65 243.4
Cla10g02086 . 76 229 Chloroplast and Mitochondria Gene Families AT2G40100 66.7 2.4e-55 212.2
Cla02g01804 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.8e-136 482.3
Cla01g02379 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 4.0e-136 481.1
Cla01g02380 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 6.8e-136 480.3
Cla10g01121 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.9 1.7e-126 449.1
Cla02g00280 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.5e-116 414.8
Cla10g00607 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 65.2 1.0e-94 343.6
Cla03g00652 . 1 256 Chloroplast and Mitochondria Gene Families AT1G29930 57.1 1.2e-68 256.9
Cla02g01804 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 6.8e-136 480.3
Cla01g02379 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 1.5e-135 479.2
Cla01g02380 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 2.6e-135 478.4
Cla10g01121 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.9 2.2e-126 448.7
Cla02g00280 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.1e-116 415.6
Cla10g00607 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 65.2 1.7e-94 342.8
Cla03g00652 . 1 256 Chloroplast and Mitochondria Gene Families AT1G29920 56.8 4.7e-68 255.0
Cla08g00194 . 101 321 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 7.2e-53 204.5
Cla02g01804 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 6.8e-136 480.3
Cla01g02379 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 1.5e-135 479.2
Cla01g02380 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 2.6e-135 478.4
Cla10g01121 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.9 2.2e-126 448.7
Cla02g00280 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.1e-116 415.6
Cla10g00607 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 65.2 1.7e-94 342.8
Cla03g00652 . 1 256 Chloroplast and Mitochondria Gene Families AT1G29910 56.8 4.7e-68 255.0
Cla08g00194 . 101 321 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 7.2e-53 204.5
Cla08g00194 . 56 336 Chloroplast and Mitochondria Gene Families AT4G10340 84.7 5.3e-139 490.7
Cla01g02380 . 81 297 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 3.9e-57 218.8
Cla01g02379 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.6e-57 218.0
Cla10g01121 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 8.6e-57 217.6
Cla02g01804 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cla02g00280 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 3.1e-54 209.1
Cla10g00607 . 48 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 3.8e-52 202.2
Cla02g01804 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.2e-135 479.6
Cla01g02379 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 1.7e-134 475.7
Cla01g02380 . 45 309 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 2.8e-134 474.9
Cla10g01121 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.7 3.4e-127 451.4
Cla02g00280 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 7.0e-117 417.2
Cla10g00607 . 24 266 Chloroplast and Mitochondria Gene Families AT2G34420 70.1 8.4e-94 340.5
Cla03g00652 . 1 256 Chloroplast and Mitochondria Gene Families AT2G34420 56.8 5.1e-67 251.5
Cla01g02380 . 45 309 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 8.0e-137 483.4
Cla01g02379 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 3.0e-136 481.5
Cla02g01804 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 2.0e-135 478.8
Cla10g01121 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.6 4.7e-129 457.6
Cla02g00280 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 1.9e-114 409.1
Cla10g00607 . 36 266 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 8.4e-94 340.5
Cla03g00652 . 1 256 Chloroplast and Mitochondria Gene Families AT2G34430 55.9 2.3e-67 252.7
Cla04g00716 . 105 382 Chloroplast and Mitochondria Gene Families AT5G01530 83.5 6.7e-137 483.8
Cla10g02086 . 73 333 Chloroplast and Mitochondria Gene Families AT5G01530 84.1 2.4e-126 448.7
Cla10g00746 . 269 528 Chloroplast and Mitochondria Gene Families AT5G40810 93.5 2.5e-143 505.0
Cla10g00746 . 233 528 Chloroplast and Mitochondria Gene Families AT3G27240 83.5 6.8e-148 520.4
Cla02g01883 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 75.3 7.1e-143 503.8
Cla04g00684 . 100 402 Chloroplast and Mitochondria Gene Families AT2G30160 64.2 9.4e-111 397.1
Cla02g01883 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 76.4 3.2e-143 505.0
Cla04g00684 . 96 402 Chloroplast and Mitochondria Gene Families AT1G07030 67.5 1.7e-117 419.5
Cla09g00508 . 1 380 Chloroplast and Mitochondria Gene Families AT2G47490 55.5 1.6e-107 386.3
Cla01g00571 . 9 374 Chloroplast and Mitochondria Gene Families AT2G47490 52.6 4.6e-99 358.2
Cla01g00571 . 10 426 Chloroplast and Mitochondria Gene Families AT1G25380 54.1 9.3e-112 400.6
Cla09g00508 . 73 349 Chloroplast and Mitochondria Gene Families AT1G25380 57.0 8.8e-86 314.3
Cla03g00519 . 597 1172 Chloroplast and Mitochondria Gene Families AT4G21490 75.6 7.3e-260 893.3
Cla02g01697 . 434 1056 Chloroplast and Mitochondria Gene Families AT4G21490 66.2 6.6e-237 817.0
Cla02g00132 . 23 596 Chloroplast and Mitochondria Gene Families AT4G21490 64.7 1.2e-225 779.6
Cla09g00073 . 847 1035 Chloroplast and Mitochondria Gene Families AT1G17530 62.5 2.6e-62 235.3
Cla06g00914 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 57.3 1.3e-50 196.4
Cla06g00914 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 57.8 1.8e-50 196.1
Cla09g00073 . 871 1035 Chloroplast and Mitochondria Gene Families AT3G04800 53.9 1.5e-41 166.4
Cla09g00073 . 864 1035 Chloroplast and Mitochondria Gene Families AT1G72750 68.4 4.6e-62 234.6
Cla06g00914 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 57.1 2.5e-52 202.2
Cla05g02337 CCT 663 837 Chloroplast and Mitochondria Gene Families AT1G26100 69.7 1.6e-67 253.1
Cla11g00506 . 1 278 Chloroplast and Mitochondria Gene Families AT5G38630 57.7 4.4e-83 304.7
Cla09g01236 . 144 351 Chloroplast and Mitochondria Gene Families AT4G25570 69.5 4.9e-84 308.1
Cla01g00658 . 2 225 Chloroplast and Mitochondria Gene Families AT1G14730 50.4 2.7e-61 232.3
Cla01g00764 . 9 356 Chloroplast and Mitochondria Gene Families AT5G14040 82.3 2.3e-169 592.0
Cla05g01339 . 10 395 Chloroplast and Mitochondria Gene Families AT5G14040 69.8 5.0e-153 537.7
Cla06g01777 . 39 329 Chloroplast and Mitochondria Gene Families AT5G14040 86.6 4.4e-149 524.6
Cla02g00337 . 11 297 Chloroplast and Mitochondria Gene Families AT5G14040 52.1 1.2e-82 303.9
Cla01g00764 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 72.0 7.6e-146 513.8
Cla05g01339 . 11 401 Chloroplast and Mitochondria Gene Families AT3G48850 65.1 1.8e-139 492.7
Cla06g01777 . 10 329 Chloroplast and Mitochondria Gene Families AT3G48850 67.6 2.3e-134 475.7
Cla02g00337 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 3.7e-84 308.9
Cla02g00337 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 76.9 1.1e-132 469.9
Cla01g00764 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.6 4.8e-85 311.6
Cla06g01777 . 44 328 Chloroplast and Mitochondria Gene Families AT2G17270 50.2 5.5e-81 298.1
Cla11g00459 . 16 343 Chloroplast and Mitochondria Gene Families AT5G15640 68.6 4.7e-120 427.9
Cla05g00729 . 47 341 Chloroplast and Mitochondria Gene Families AT5G15640 50.2 5.9e-78 288.1
Cla05g01857 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 66.8 1.2e-124 443.4
Cla09g00079 . 1 344 Chloroplast and Mitochondria Gene Families AT5G26200 57.8 1.8e-104 376.3
Cla09g00079 . 1 348 Chloroplast and Mitochondria Gene Families AT1G72820 75.8 2.3e-147 518.8
Cla05g01857 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 5.1e-131 464.5
Cla01g00235 CCT,ECH 82 285 Chloroplast and Mitochondria Gene Families AT5G52570 52.5 2.3e-50 196.1
Cla05g00912 CCT,ECH 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.2 1.2e-69 260.0
Cla01g00235 CCT,ECH 31 204 Chloroplast and Mitochondria Gene Families AT4G25700 62.2 1.5e-56 216.5
Cla02g00146 . 177 355 Chloroplast and Mitochondria Gene Families AT4G03320 52.2 8.8e-57 217.6
Cla10g00609 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.0 9.1e-120 427.2
Cla06g01286 . 43 546 Chloroplast and Mitochondria Gene Families AT2G18710 83.9 4.7e-240 827.4
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001660 3 2 4 3 4 2 3 2 2 2 2 2 4 2 2 4 2 1 4 2 2 2 2 2 2 2 1 2 2 1 70
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cla04g00684 Cla_Chr04 FPKM 4.546296 3.770101 4.198906 2.877325 5.304846 3.183012 3.225507 5.686722 4.610841 4.503216