Cucurbitales platform

Gene search

Sequence information

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Cla09g00508	ATGGCTACCGATTCTCATGCCCCTACTCCAAGAGGTCTTCTCTGTAATGCTGGGGCTGGTGCTGCTGCTGGTATTTCCATCTCTTTCTCTCCGTTTACGGTTTCTCTGTGTTGTCGATTGAGTTTAAATTTGTGGGATTTCAAACTGAAAGATTTTGCTTCAGATTTATATCTGTTTGTTGCGCTTGTTTGGATGATTGAGAAGAGAGGAGTGAGGGGAGTTCTTGCTGCTACGTTTGTTTGCCCTTTGGATGTTATCAAGACGAGATTTCAGGTTCATGGATTGCCAAACATCGGTAAAGGGAGTCTTATAGTTGGTAGTCTGCAACAAATTTTTCATAAGGAGGGGTTACGTGGAATGTATAGAGGTCTCGCACCTACTGTGCTTGCATTACTTCCTAACTGGGCTGTTTACTTCACAATATATGGGCAGCTTAAAAGCTTTCTTGGCTCTGATGGTGAAAATCGTCAGCTTTCAATAGGTGCTAATATGATGGCTGCTTCTGGTGCCGGGGCTGCTACAACTATTGCAACCAATCCTCTATGGGTAGTTAAGACCAGGCTACAGACACAGGGAATGAAATCTGGTGTGCTACCATATAGAAATACAGTGTCTGCCTTGAGGAGAATAGCCTCTGAAGAAGGCATTCGTGGATTGTACAGTGGGCTTGTACCTGCTTTGGCTGGTGTAAGTCACGTTGCGATCCAGTTTCCAACATATGAAAAAATAAAAAGTTATTTGGCTAGAAGAGACAATACGACAACGGACAAACTCACTGCACGCGATGTTGCGGTCGCCTCCTCTGTCTCCAAGATATTTGCTTCTACATTGACCTATCCACACGAGATCAAAATCCTTGACATTCTAAAAGGTCATTACTTAGGGTTTGGTATTCATAACATTTCAGTCTCATTGAGACAAACTCAACTGGTTGTACGATCCAGGCTTCAGGAACAAGGGTTTCACTCTGAGAAGCGTTATTCTGGGGTAGCCGATTGCGTAAAGAAAGTATTTCAACAAGATGGTCTCCCTGGTTTCTATAGAGGGTACACTAATTGCCCCCCAGTAGTTTGTAGCAGCAACTCAAAACATTCTTGCCACAGTAAAGCTTCAATGTTATCAAGCCTGCCTTTAAAACATGATGACGACGACAATGAAAATGACAATAATAGATACACTGAACCCTCTGGAACCTTCTTCGTATTCTTCCTCTGTTTTAAACCCACGTCGCATCGCATCCATGCAATTTCCTTGCCCTTCACAATAAACATTATTATTCCAGAGTTTTTCCGGCGAAACAAAACAATGTCGGGTGGTGGGTTTTGTTATTATTCTGTTCTTGGCCTGTGTAAGCAAGCTTCTGCCGATGAAATCCGATCAGCTTACCGTAAACTAGCCATGAAATGGCATCCCGATAAGTGGATCAAACATCCAGAAATGGCCGCTGAATCTAAAACCCGCTTTCAGCAAATTCAACAAGCTTATTCAGTTCTATCAAACAAGGGAAAGAGAAGCATATACGATGCCGGATTGATTTCATTTTTGACAGACGATGATGACGAAGGATTTTGTGATTTCATGATCGAAATGGTATCAATGATGAAGAGCGCCACACAGCAGGGGAAGAAGAAGAAGAAGATGAAGAACAGTTTGGAGGATCTAAGAGGAACATTAATGGAGATGATGGGAGCCGATGATGAACAAGCTGAGGAATTAGGGCTCGGCTGGGGATCTTCTTCTCCTCCTCCTCCTCTTAATGCCAAAAAAAGAAGTCGATTTCCTTAG	1785	42.91	MATDSHAPTPRGLLCNAGAGAAAGISISFSPFTVSLCCRLSLNLWDFKLKDFASDLYLFVALVWMIEKRGVRGVLAATFVCPLDVIKTRFQVHGLPNIGKGSLIVGSLQQIFHKEGLRGMYRGLAPTVLALLPNWAVYFTIYGQLKSFLGSDGENRQLSIGANMMAASGAGAATTIATNPLWVVKTRLQTQGMKSGVLPYRNTVSALRRIASEEGIRGLYSGLVPALAGVSHVAIQFPTYEKIKSYLARRDNTTTDKLTARDVAVASSVSKIFASTLTYPHEIKILDILKGHYLGFGIHNISVSLRQTQLVVRSRLQEQGFHSEKRYSGVADCVKKVFQQDGLPGFYRGYTNCPPVVCSSNSKHSCHSKASMLSSLPLKHDDDDNENDNNRYTEPSGTFFVFFLCFKPTSHRIHAISLPFTINIIIPEFFRRNKTMSGGGFCYYSVLGLCKQASADEIRSAYRKLAMKWHPDKWIKHPEMAAESKTRFQQIQQAYSVLSNKGKRSIYDAGLISFLTDDDDEGFCDFMIEMVSMMKSATQQGKKKKKMKNSLEDLRGTLMEMMGADDEQAEELGLGWGSSSPPPPLNAKKRSRFP	594

Gff information

Chromosome	Start	End	Strand	Old_gene	Gene	Num
9	4790154	4797949	+	ClCG09G005470.2	Cla09g00508	279928

Annotation

Seq ID	Length	Analysis	Description	Start	End	IPR	GO
Cla09g00508	594	PRINTS	DnaJ domain signature	483	503	IPR001623	-
Cla09g00508	594	PRINTS	DnaJ domain signature	444	462	IPR001623	-
Cla09g00508	594	PRINTS	DnaJ domain signature	462	477	IPR001623	-
Cla09g00508	594	SUPERFAMILY	Chaperone J-domain	438	507	IPR036869	-
Cla09g00508	594	ProSiteProfiles	Solute carrier (Solcar) repeat profile.	286	373	IPR018108	-
Cla09g00508	594	ProSitePatterns	Nt-dnaJ domain signature.	488	507	IPR018253	-
Cla09g00508	594	CDD	DnaJ	442	500	IPR001623	-
Cla09g00508	594	ProSiteProfiles	Solute carrier (Solcar) repeat profile.	158	246	IPR018108	-
Cla09g00508	594	PANTHER	MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED	308	350	IPR044712	GO:0006862\|GO:0055085
Cla09g00508	594	Pfam	DnaJ domain	443	508	IPR001623	-
Cla09g00508	594	PANTHER	NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1, CHLOROPLASTIC	308	350	-	-
Cla09g00508	594	PANTHER	NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1, CHLOROPLASTIC	72	283	-	-
Cla09g00508	594	Gene3D	DnaJ domain	431	527	IPR036869	-
Cla09g00508	594	PANTHER	MITOCHONDRIAL NICOTINAMIDE ADENINE DINUCLEOTIDE TRANSPORTER 1-RELATED-RELATED	72	283	IPR044712	GO:0006862\|GO:0055085
Cla09g00508	594	ProSiteProfiles	Solute carrier (Solcar) repeat profile.	60	148	IPR018108	-
Cla09g00508	594	SMART	dnaj_3	441	503	IPR001623	-
Cla09g00508	594	ProSiteProfiles	dnaJ domain profile.	442	511	IPR001623	-
Cla09g00508	594	Pfam	Mitochondrial carrier protein	157	249	IPR018108	-
Cla09g00508	594	Pfam	Mitochondrial carrier protein	311	351	IPR018108	-
Cla09g00508	594	Pfam	Mitochondrial carrier protein	71	150	IPR018108	-
Cla09g00508	594	SUPERFAMILY	Mitochondrial carrier	70	351	IPR023395	-
Cla09g00508	594	MobiDBLite	consensus disorder prediction	569	594	-	-
Cla09g00508	594	Gene3D	Mitochondrial carrier domain	68	357	IPR023395	-

Pathway

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Cla09g00508	K15115	SLC25A32, MFT; solute carrier family 25 (mitochondrial folate transporter), member 32	-	csv:101204681	464.151

Dupl-types

Gene1	Location1	Gene2	Location2	E-value	Duplicated-type
Cla01g00571	Cla-Chr1:6431391	Cla09g00508	Cla-Chr9:4790154	5.83E-13	dispersed
Cla01g01945	Cla-Chr1:34117062	Cla09g00508	Cla-Chr9:4790154	1.46E-08	dispersed
Cla02g01495	Cla-Chr2:29465391	Cla09g00508	Cla-Chr9:4790154	1.98E-39	dispersed
Cla06g01543	Cla-Chr6:29014429	Cla09g00508	Cla-Chr9:4790154	7.02E-14	dispersed
Cla09g00112	Cla-Chr9:1144075	Cla09g00508	Cla-Chr9:4790154	3.61E-23	dispersed
Cla09g00508	Cla-Chr9:4790154	Cla06g00488	Cla-Chr6:5907481	8.02E-06	dispersed
Cla09g00508	Cla-Chr9:4790154	Cla09g01135	Cla-Chr9:12705302	1.57E-13	transposed

Deco-Alignment

Select	Vvi1	Blo1	Blo2	Bda1	Bda2	Bpe1	Bpe2	Bma1	Bma2	Cmo1	Cmo2	Cma1	Cma2	Car1	Car2	Sed1	Cpe1	Cpe2	Bhi1	Tan1	Cmetu1	Lac1	Hepe1	Mch1	Lcy1	Cla1	Cam1	Cec1	Cco1	Clacu1	Cmu1	Cre1	Cone1	Cone2	Cone3	Cone4	Lsi1	Csa1	Chy1	Cme1	Blo3	Blo4	Bda3	Bda4	Bpe3	Bpe4	Bma3	Bma4	Sed2	Cmo3	Cmo4	Cma3	Cma4	Car3	Car4	Cpe3	Cpe4	Bhi2	Tan2	Cmetu2	Lac2	Hepe2	Mch2	Lcy2	Cla2	Cam2	Cec2	Cco2	Clacu2	Cmu2	Cre2	Lsi2	Csa2	Chy2	Cme2
	Vvi7g348	.	.	.	.	.	.	Bma13g00073	.	Cmo08g00433	Cmo17g01033	.	.	.	.	Sed07g0813	Cpe17g00770	.	Bhi09g00933	Tan06g0765	Cmetu09g1187	.	Hepe03g1870	.	.	Cla09g00508	Cam09g0550	Cec09g0540	Cco09g0536	Clacu09g0550	.	Cre09g0528	Cone17ag0445	Cone20ag0967	.	.	Lsi02g02438	Csa07g01874	.	Cme01g02233	.	.	.	.	.	.	.	.	.	.	.	Cma08g00444	.	.	Car17g01010	.	Cpe12g00913	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	Chy01g01724	.

Syn-Families

Gene	Event_type	S_start	S_end	Function	Ath_gene	Identity(%)	E-value	Score
Cla03g00157	.	187	629	Chloroplast and Mitochondria Gene Families	AT2G28800	59.0	4.8e-131	464.9
Cla08g01713	.	72	352	Chloroplast and Mitochondria Gene Families	AT2G28800	54.5	5.2e-77	285.4
Cla08g00704	.	3	249	Chloroplast and Mitochondria Gene Families	AT1G15820	81.9	5.2e-117	417.5
Cla02g00280	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	88.7	1.1e-142	503.1
Cla02g01804	.	2	267	Chloroplast and Mitochondria Gene Families	AT3G27690	78.4	6.9e-121	430.6
Cla01g02379	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	77.4	3.4e-120	428.3
Cla01g02380	.	46	309	Chloroplast and Mitochondria Gene Families	AT3G27690	76.7	2.9e-119	425.2
Cla10g01121	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	78.0	6.5e-119	424.1
Cla10g00607	.	5	266	Chloroplast and Mitochondria Gene Families	AT3G27690	66.9	1.2e-96	350.1
Cla11g01861	.	113	329	Chloroplast and Mitochondria Gene Families	AT3G27690	51.2	1.1e-52	204.1
Cla08g00194	.	118	321	Chloroplast and Mitochondria Gene Families	AT3G27690	53.8	6.8e-52	201.4
Cla11g01337	.	3	268	Chloroplast and Mitochondria Gene Families	AT3G61470	80.9	1.3e-128	456.1
Cla03g01434	.	56	261	Chloroplast and Mitochondria Gene Families	AT3G61470	65.5	2.8e-86	315.5
Cla06g01586	CCT,ECH	368	595	Chloroplast and Mitochondria Gene Families	AT3G61470	50.8	8.7e-64	240.7
Cla09g02009	.	1	198	Chloroplast and Mitochondria Gene Families	AT3G54890	81.6	5.9e-90	327.4
Cla04g00716	.	105	382	Chloroplast and Mitochondria Gene Families	AT3G08940	82.1	7.6e-133	470.3
Cla10g02086	.	76	333	Chloroplast and Mitochondria Gene Families	AT3G08940	81.3	1.1e-118	423.3
Cla11g01861	.	48	336	Chloroplast and Mitochondria Gene Families	AT1G76570	79.2	4.6e-142	501.1
Cla03g01160	.	1	273	Chloroplast and Mitochondria Gene Families	AT1G61520	86.8	8.2e-137	483.4
Cla02g00280	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G05070	89.4	3.0e-144	508.1
Cla01g02379	.	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	79.3	1.0e-120	429.9
Cla01g02380	.	49	309	Chloroplast and Mitochondria Gene Families	AT2G05070	78.6	5.2e-120	427.6
Cla02g01804	.	7	267	Chloroplast and Mitochondria Gene Families	AT2G05070	78.9	6.8e-120	427.2
Cla10g01121	.	27	265	Chloroplast and Mitochondria Gene Families	AT2G05070	84.5	1.7e-118	422.5
Cla10g00607	.	7	266	Chloroplast and Mitochondria Gene Families	AT2G05070	68.0	3.6e-97	351.7
Cla03g00652	.	27	256	Chloroplast and Mitochondria Gene Families	AT2G05070	50.4	2.1e-52	203.0
Cla08g00194	.	118	321	Chloroplast and Mitochondria Gene Families	AT2G05070	54.3	4.6e-52	201.8
Cla11g01861	.	113	329	Chloroplast and Mitochondria Gene Families	AT2G05070	50.2	3.0e-51	199.1
Cla02g00280	.	1	237	Chloroplast and Mitochondria Gene Families	AT2G05100	89.5	1.7e-125	446.0
Cla01g02379	.	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	76.9	5.8e-102	367.9
Cla01g02380	.	49	281	Chloroplast and Mitochondria Gene Families	AT2G05100	76.4	1.7e-101	366.3
Cla02g01804	.	7	239	Chloroplast and Mitochondria Gene Families	AT2G05100	76.9	5.0e-101	364.8
Cla10g01121	.	27	237	Chloroplast and Mitochondria Gene Families	AT2G05100	83.4	1.9e-100	362.8
Cla10g00607	.	7	238	Chloroplast and Mitochondria Gene Families	AT2G05100	67.6	5.1e-82	301.6
Cla08g00194	.	118	305	Chloroplast and Mitochondria Gene Families	AT2G05100	53.1	1.6e-43	173.7
Cla04g00716	.	105	264	Chloroplast and Mitochondria Gene Families	AT2G40100	72.0	9.7e-65	243.4
Cla10g02086	.	76	229	Chloroplast and Mitochondria Gene Families	AT2G40100	66.7	2.4e-55	212.2
Cla02g01804	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29930	88.4	1.8e-136	482.3
Cla01g02379	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	88.8	4.0e-136	481.1
Cla01g02380	.	45	309	Chloroplast and Mitochondria Gene Families	AT1G29930	88.4	6.8e-136	480.3
Cla10g01121	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29930	84.9	1.7e-126	449.1
Cla02g00280	.	3	265	Chloroplast and Mitochondria Gene Families	AT1G29930	78.3	3.5e-116	414.8
Cla10g00607	.	1	266	Chloroplast and Mitochondria Gene Families	AT1G29930	65.2	1.0e-94	343.6
Cla03g00652	.	1	256	Chloroplast and Mitochondria Gene Families	AT1G29930	57.1	1.2e-68	256.9
Cla02g01804	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29920	88.1	6.8e-136	480.3
Cla01g02379	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	88.4	1.5e-135	479.2
Cla01g02380	.	45	309	Chloroplast and Mitochondria Gene Families	AT1G29920	88.0	2.6e-135	478.4
Cla10g01121	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29920	84.9	2.2e-126	448.7
Cla02g00280	.	3	265	Chloroplast and Mitochondria Gene Families	AT1G29920	77.9	2.1e-116	415.6
Cla10g00607	.	1	266	Chloroplast and Mitochondria Gene Families	AT1G29920	65.2	1.7e-94	342.8
Cla03g00652	.	1	256	Chloroplast and Mitochondria Gene Families	AT1G29920	56.8	4.7e-68	255.0
Cla08g00194	.	101	321	Chloroplast and Mitochondria Gene Families	AT1G29920	50.7	7.2e-53	204.5
Cla02g01804	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29910	88.1	6.8e-136	480.3
Cla01g02379	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	88.4	1.5e-135	479.2
Cla01g02380	.	45	309	Chloroplast and Mitochondria Gene Families	AT1G29910	88.0	2.6e-135	478.4
Cla10g01121	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29910	84.9	2.2e-126	448.7
Cla02g00280	.	3	265	Chloroplast and Mitochondria Gene Families	AT1G29910	77.9	2.1e-116	415.6
Cla10g00607	.	1	266	Chloroplast and Mitochondria Gene Families	AT1G29910	65.2	1.7e-94	342.8
Cla03g00652	.	1	256	Chloroplast and Mitochondria Gene Families	AT1G29910	56.8	4.7e-68	255.0
Cla08g00194	.	101	321	Chloroplast and Mitochondria Gene Families	AT1G29910	50.7	7.2e-53	204.5
Cla08g00194	.	56	336	Chloroplast and Mitochondria Gene Families	AT4G10340	84.7	5.3e-139	490.7
Cla01g02380	.	81	297	Chloroplast and Mitochondria Gene Families	AT4G10340	52.9	3.9e-57	218.8
Cla01g02379	.	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.5	6.6e-57	218.0
Cla10g01121	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	8.6e-57	217.6
Cla02g01804	.	51	255	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	1.1e-56	217.2
Cla02g00280	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.6	3.1e-54	209.1
Cla10g00607	.	48	254	Chloroplast and Mitochondria Gene Families	AT4G10340	54.0	3.8e-52	202.2
Cla02g01804	.	1	267	Chloroplast and Mitochondria Gene Families	AT2G34420	88.4	1.2e-135	479.6
Cla01g02379	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	88.0	1.7e-134	475.7
Cla01g02380	.	45	309	Chloroplast and Mitochondria Gene Families	AT2G34420	87.6	2.8e-134	474.9
Cla10g01121	.	4	265	Chloroplast and Mitochondria Gene Families	AT2G34420	85.7	3.4e-127	451.4
Cla02g00280	.	3	265	Chloroplast and Mitochondria Gene Families	AT2G34420	77.2	7.0e-117	417.2
Cla10g00607	.	24	266	Chloroplast and Mitochondria Gene Families	AT2G34420	70.1	8.4e-94	340.5
Cla03g00652	.	1	256	Chloroplast and Mitochondria Gene Families	AT2G34420	56.8	5.1e-67	251.5
Cla01g02380	.	45	309	Chloroplast and Mitochondria Gene Families	AT2G34430	88.3	8.0e-137	483.4
Cla01g02379	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	88.3	3.0e-136	481.5
Cla02g01804	.	1	267	Chloroplast and Mitochondria Gene Families	AT2G34430	88.1	2.0e-135	478.8
Cla10g01121	.	4	265	Chloroplast and Mitochondria Gene Families	AT2G34430	85.6	4.7e-129	457.6
Cla02g00280	.	31	265	Chloroplast and Mitochondria Gene Families	AT2G34430	83.2	1.9e-114	409.1
Cla10g00607	.	36	266	Chloroplast and Mitochondria Gene Families	AT2G34430	70.5	8.4e-94	340.5
Cla03g00652	.	1	256	Chloroplast and Mitochondria Gene Families	AT2G34430	55.9	2.3e-67	252.7
Cla04g00716	.	105	382	Chloroplast and Mitochondria Gene Families	AT5G01530	83.5	6.7e-137	483.8
Cla10g02086	.	73	333	Chloroplast and Mitochondria Gene Families	AT5G01530	84.1	2.4e-126	448.7
Cla10g00746	.	269	528	Chloroplast and Mitochondria Gene Families	AT5G40810	93.5	2.5e-143	505.0
Cla10g00746	.	233	528	Chloroplast and Mitochondria Gene Families	AT3G27240	83.5	6.8e-148	520.4
Cla02g01883	.	5	327	Chloroplast and Mitochondria Gene Families	AT2G30160	75.3	7.1e-143	503.8
Cla04g00684	.	100	402	Chloroplast and Mitochondria Gene Families	AT2G30160	64.2	9.4e-111	397.1
Cla02g01883	.	5	323	Chloroplast and Mitochondria Gene Families	AT1G07030	76.4	3.2e-143	505.0
Cla04g00684	.	96	402	Chloroplast and Mitochondria Gene Families	AT1G07030	67.5	1.7e-117	419.5
Cla09g00508	.	1	380	Chloroplast and Mitochondria Gene Families	AT2G47490	55.5	1.6e-107	386.3
Cla01g00571	.	9	374	Chloroplast and Mitochondria Gene Families	AT2G47490	52.6	4.6e-99	358.2
Cla01g00571	.	10	426	Chloroplast and Mitochondria Gene Families	AT1G25380	54.1	9.3e-112	400.6
Cla09g00508	.	73	349	Chloroplast and Mitochondria Gene Families	AT1G25380	57.0	8.8e-86	314.3
Cla03g00519	.	597	1172	Chloroplast and Mitochondria Gene Families	AT4G21490	75.6	7.3e-260	893.3
Cla02g01697	.	434	1056	Chloroplast and Mitochondria Gene Families	AT4G21490	66.2	6.6e-237	817.0
Cla02g00132	.	23	596	Chloroplast and Mitochondria Gene Families	AT4G21490	64.7	1.2e-225	779.6
Cla09g00073	.	847	1035	Chloroplast and Mitochondria Gene Families	AT1G17530	62.5	2.6e-62	235.3
Cla06g00914	.	4	179	Chloroplast and Mitochondria Gene Families	AT1G17530	57.3	1.3e-50	196.4
Cla06g00914	.	12	183	Chloroplast and Mitochondria Gene Families	AT3G04800	57.8	1.8e-50	196.1
Cla09g00073	.	871	1035	Chloroplast and Mitochondria Gene Families	AT3G04800	53.9	1.5e-41	166.4
Cla09g00073	.	864	1035	Chloroplast and Mitochondria Gene Families	AT1G72750	68.4	4.6e-62	234.6
Cla06g00914	.	5	183	Chloroplast and Mitochondria Gene Families	AT1G72750	57.1	2.5e-52	202.2
Cla05g02337	CCT	663	837	Chloroplast and Mitochondria Gene Families	AT1G26100	69.7	1.6e-67	253.1
Cla11g00506	.	1	278	Chloroplast and Mitochondria Gene Families	AT5G38630	57.7	4.4e-83	304.7
Cla09g01236	.	144	351	Chloroplast and Mitochondria Gene Families	AT4G25570	69.5	4.9e-84	308.1
Cla01g00658	.	2	225	Chloroplast and Mitochondria Gene Families	AT1G14730	50.4	2.7e-61	232.3
Cla01g00764	.	9	356	Chloroplast and Mitochondria Gene Families	AT5G14040	82.3	2.3e-169	592.0
Cla05g01339	.	10	395	Chloroplast and Mitochondria Gene Families	AT5G14040	69.8	5.0e-153	537.7
Cla06g01777	.	39	329	Chloroplast and Mitochondria Gene Families	AT5G14040	86.6	4.4e-149	524.6
Cla02g00337	.	11	297	Chloroplast and Mitochondria Gene Families	AT5G14040	52.1	1.2e-82	303.9
Cla01g00764	.	8	356	Chloroplast and Mitochondria Gene Families	AT3G48850	72.0	7.6e-146	513.8
Cla05g01339	.	11	401	Chloroplast and Mitochondria Gene Families	AT3G48850	65.1	1.8e-139	492.7
Cla06g01777	.	10	329	Chloroplast and Mitochondria Gene Families	AT3G48850	67.6	2.3e-134	475.7
Cla02g00337	.	11	297	Chloroplast and Mitochondria Gene Families	AT3G48850	50.5	3.7e-84	308.9
Cla02g00337	.	14	308	Chloroplast and Mitochondria Gene Families	AT2G17270	76.9	1.1e-132	469.9
Cla01g00764	.	62	352	Chloroplast and Mitochondria Gene Families	AT2G17270	52.6	4.8e-85	311.6
Cla06g01777	.	44	328	Chloroplast and Mitochondria Gene Families	AT2G17270	50.2	5.5e-81	298.1
Cla11g00459	.	16	343	Chloroplast and Mitochondria Gene Families	AT5G15640	68.6	4.7e-120	427.9
Cla05g00729	.	47	341	Chloroplast and Mitochondria Gene Families	AT5G15640	50.2	5.9e-78	288.1
Cla05g01857	.	12	345	Chloroplast and Mitochondria Gene Families	AT5G26200	66.8	1.2e-124	443.4
Cla09g00079	.	1	344	Chloroplast and Mitochondria Gene Families	AT5G26200	57.8	1.8e-104	376.3
Cla09g00079	.	1	348	Chloroplast and Mitochondria Gene Families	AT1G72820	75.8	2.3e-147	518.8
Cla05g01857	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	68.8	5.1e-131	464.5
Cla01g00235	CCT,ECH	82	285	Chloroplast and Mitochondria Gene Families	AT5G52570	52.5	2.3e-50	196.1
Cla05g00912	CCT,ECH	1	219	Chloroplast and Mitochondria Gene Families	AT4G25700	63.2	1.2e-69	260.0
Cla01g00235	CCT,ECH	31	204	Chloroplast and Mitochondria Gene Families	AT4G25700	62.2	1.5e-56	216.5
Cla02g00146	.	177	355	Chloroplast and Mitochondria Gene Families	AT4G03320	52.2	8.8e-57	217.6
Cla10g00609	.	72	359	Chloroplast and Mitochondria Gene Families	AT5G54290	79.0	9.1e-120	427.2
Cla06g01286	.	43	546	Chloroplast and Mitochondria Gene Families	AT2G18710	83.9	4.7e-240	827.4

Syn-Orthogroups

Select	Orthogroup	Bda	Bhi	Blo	Bma	Bpe	Cam	Car	Cco	Cec	Chy	Cla	Clacu	Cma	Cme	Cmetu	Cmo	Cmu	Cone	Cpe	Cre	Csa	HCH	Hepe	Lac	Lcy	Lsi	Mch	Sed	Tan	Vvi	Total
	OG0002161	2	2	0	1	2	2	3	2	2	2	2	2	2	2	2	3	2	4	2	2	2	2	2	2	2	2	2	4	2	2	63

Transcriptome

Select	Gene	Chr	Type	da1	da2	da3	da4	da5	da6	da7	da8	da9	da10
	Cla09g00508	Cla_Chr09	FPKM	20.074747	20.882637	23.840181	24.762129	12.804101	13.932026	12.925033	26.174067	24.560562	27.589941