Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Clacu01g1572 ATGAACGATCTGTTTTCCACCGATTCCTTCCGCCGACAGCAGCACCGCCATGACTCCGTCGAGATTCCCGACAACGCGCCGTCGTCAACGACTATCAATCTCAACAGTTTCTTCGACGACGTGGAGTCCGTGAAGGCAGAATTGACGGAGCTCGAACGCCTGTATCGAAGCCTCCAGAATTCTCACGAGCAGAGCAAAACTCTTCACAATTCGAAGGCGATTAAGGATCTTCGATCGCGAATGGAATCGGATGTGACTCTGGCTCTGAAGAAGGCTAGGTTTATCAAGCTCCGGTTGGAGGAACTGGACCGGTCCAATGCCGAGAACCGGAATCTTCCTGGTTGTGGCTATGGCTCCTCCGCCGACCGGTCAAGAACTTCCGTCGTCAATGGATTGAGGAAGAAGCTGTGTGATTCGATGGAGAGTTTCAATAGATTGAGAGAGGAGATTTCGTCGACGTATAAGGAGACGATTGAACGAAGGTATTTCACAATTACAGGGGAAAATCCTGATGAGAAGACGGTTGATTTGTTGATCTCTACAGGCGAAAGCGAAACATTCTTGCAAAAAGCAATACAAAAGCAAGGAAGAGGAAGAGTTTTGGAAACAATCCAAGAGATTCAAGAAAGGCATGACGCAGTGAAAGACATAGAGAGGAATTTGAGAGAGCTGCACCAAGTTTTCATGGACATGGCGGTGCTGGTTCAATCTCAGGGGCAGCACTTGGACGATATCGAGAGCCAAGTGACTCGAGCCAACTCCGCTGTCAAGCGCGGCACCACGGAGCTACAAACTGCAAGATACTACCAGAAAAACACTCGCAAATGGATCTGCATAGGCGTCATCGTTCTCGCACTCATTCTCTTCATCATTATCATCTCCGTCGTCCTTTCCAAGAAGTAG 903 48.84 MNDLFSTDSFRRQQHRHDSVEIPDNAPSSTTINLNSFFDDVESVKAELTELERLYRSLQNSHEQSKTLHNSKAIKDLRSRMESDVTLALKKARFIKLRLEELDRSNAENRNLPGCGYGSSADRSRTSVVNGLRKKLCDSMESFNRLREEISSTYKETIERRYFTITGENPDEKTVDLLISTGESETFLQKAIQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQVFMDMAVLVQSQGQHLDDIESQVTRANSAVKRGTTELQTARYYQKNTRKWICIGVIVLALILFIIIISVVLSKK 300
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
1 27813200 27814756 + ClG42_01g0157200.10 Clacu01g1572 240956

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Clacu01g1572 300 Gene3D - 199 298 - -
Clacu01g1572 300 PANTHER SYNTAXIN 36 287 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Clacu01g1572 300 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 31 161 - -
Clacu01g1572 300 Pfam Syntaxin 36 239 IPR006011 GO:0016020(InterPro)
Clacu01g1572 300 ProSitePatterns Syntaxin / epimorphin family signature. 210 249 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Clacu01g1572 300 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 204 266 IPR000727 -
Clacu01g1572 300 CDD SynN 34 191 IPR006011 GO:0016020(InterPro)
Clacu01g1572 300 Pfam SNARE domain 242 292 IPR000727 -
Clacu01g1572 300 Coils Coil 34 68 - -
Clacu01g1572 300 MobiDBLite consensus disorder prediction 1 27 - -
Clacu01g1572 300 CDD SNARE_syntaxin1-like 203 265 - -
Clacu01g1572 300 FunFam Syntaxin 132 197 297 - -
Clacu01g1572 300 SMART tSNARE_6 199 266 IPR000727 -
Clacu01g1572 300 SUPERFAMILY t-snare proteins 33 259 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Clacu01g1572 300 SMART SynN_4 29 155 IPR006011 GO:0016020(InterPro)
Clacu01g1572 300 Gene3D - 32 164 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Clacu01g1572 K08486 - - csv:101213199 496.123
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Clacu01g1572 Clacu-Chr1:27813200 Clacu10g1804 Clacu-Chr10:31661178 1.60E-111 dispersed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Clacu08g1440 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.0e-84 309.7
Clacu04g0566 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 3.5e-101 365.2
Clacu01g2023 . 516 817 SNARE and Associated Proteins AT2G18260 54.4 9.2e-86 313.9
Clacu10g1804 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.3e-115 411.8
Clacu01g1572 . 26 282 SNARE and Associated Proteins AT3G11820 72.8 8.5e-103 370.5
Clacu03g0558 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.0e-92 337.0
Clacu10g1344 . 30 284 SNARE and Associated Proteins AT3G11820 52.5 4.7e-69 258.5
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.6e-92 334.7
Clacu01g1572 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.3e-85 312.8
Clacu03g0558 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.9e-108 388.7
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 1.5e-83 306.6
Clacu01g1572 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 3.7e-79 292.0
Clacu10g1344 . 1 284 SNARE and Associated Proteins AT4G03330 52.1 7.8e-69 257.7
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.6e-128 453.4
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT1G61290 63.1 4.2e-91 331.6
Clacu01g1572 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.6e-85 313.2
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 3.4e-93 338.6
Clacu01g1572 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 1.1e-86 317.0
Clacu10g1344 . 1 303 SNARE and Associated Proteins AT3G03800 73.9 4.7e-114 407.9
Clacu02g0875 . 41 327 SNARE and Associated Proteins AT3G03800 55.6 2.0e-80 296.2
Clacu10g1344 . 1 202 SNARE and Associated Proteins AT5G08080 78.8 1.4e-80 296.2
Clacu02g0875 . 27 227 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Clacu10g0141 . 1 253 SNARE and Associated Proteins AT5G16830 59.5 1.9e-74 276.2
Clacu10g0141 . 1 253 SNARE and Associated Proteins AT5G46860 66.0 9.6e-79 290.4
Clacu10g0141 . 1 242 SNARE and Associated Proteins AT4G17730 63.2 4.5e-73 271.6
Clacu10g0141 . 65 253 SNARE and Associated Proteins AT1G32270 59.8 1.1e-50 197.6
Clacu07g0410 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 3.1e-111 398.7
Clacu08g1440 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.0e-84 309.7
Clacu02g1560 . 32 358 SNARE and Associated Proteins AT5G26980 76.8 4.6e-128 454.5
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT5G26980 66.2 2.5e-102 369.0
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 1.1e-105 380.2
Clacu02g1560 . 32 360 SNARE and Associated Proteins AT4G02195 64.4 3.2e-105 378.6
Clacu02g1560 . 32 359 SNARE and Associated Proteins AT3G05710 76.3 3.9e-130 461.5
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT3G05710 63.7 1.0e-98 357.1
Clacu09g1107 . 84 316 SNARE and Associated Proteins AT1G16240 72.1 2.3e-89 325.5
Clacu10g0465 . 905 1137 SNARE and Associated Proteins AT1G16240 67.8 3.2e-83 305.1
Clacu09g1107 . 83 316 SNARE and Associated Proteins AT1G79590 71.4 3.8e-88 321.6
Clacu10g0465 . 900 1137 SNARE and Associated Proteins AT1G79590 67.2 1.5e-84 309.7
Clacu06g0052 . 168 358 SNARE and Associated Proteins AT1G28490 71.7 8.2e-67 250.4
Clacu10g2011 . 1 264 SNARE and Associated Proteins AT3G09740 79.7 2.6e-113 405.2
Clacu02g2162 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 9.4e-95 343.6
Clacu02g2162 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.5e-92 334.0
Clacu10g2011 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 8.6e-88 320.5
Clacu10g2011 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 7.1e-95 344.0
Clacu02g2162 . 1 262 SNARE and Associated Proteins AT3G61450 61.0 1.9e-84 309.3
Clacu11g0790 . 65 290 SNARE and Associated Proteins AT1G51740 69.3 1.1e-78 290.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62