Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Clacu04g0566 ATGAACGACTTGATGACCAAATCGTTCACCAGCTATGTGGATCTGAAGAAGGCAGCCATGAAAGATCTCGACCTCGAAGCTGGTTTAGAAATGCCATCGTCCGCTACCGGAGACAACGGTGACATGGGTCTTTTTCTTGAAGAAGCTGAGAAGGTGAAAATGGAGATGGGTTCAATTAGAGAGATTTTAGTTAAACTCCAACAAGCTAATGAGGAGACCAAATCTGCTCACAAACCCGAAACTCTCAAATCGCTTCGTAATACGATCAATGTCGACATTGTCACCGTCCTGAAAAAGGCGCGATCGATCCGATCTCAGCTTGAGGAAATGGACCGTGCCAATGCTGCAAAGAAACGTCTTTCTGGCAGCAAAGAAGGCACTGCCATTTACCGGACGAGAATTGCGGTGACAAACGGGCTGCGGAAGAAGCTAAAGGAATTGATGATGGAGTTCCAGAGCTTGAGGCAGAGGATGATGACGGAGTACAAGGAAACGGTCGGGCGAAGGTATTTCACGGTGACGGGGGAGCATCCGGAGGAGGAGGTGATAGAGAAGATAATATCCAATGGAGGAGAGGAGTTTTTGGGGAGGGCGATAGAGGAGCACGGGCAGGGGAAAGTGGCAGAGACGGTGGTGGAGATACAAGACCGACACGGGGCGGCGAAGGAGATAGAGAAGAGTTTGCTAGAGCTACACCAAGTGTTTTTGGATATGGCAGTGATGGTTGAAGCACAAGGGGAAAAAATGGATGATATTGAACATCATGTGATGAATGCTTCACAATATGTTAGGGATGGGACTAAGGATTTGAAGACTGCAAAAGATTTGCAAAGGAACAGTAGGAAATGTATGTGTTTTGGGATTTTTCTTTTGCTTCTGATTATTTTGGTTGTTGTTATTCCTATTGCTGTTAGTTTTGGAAGTTCTTGA 930 46.13 MNDLMTKSFTSYVDLKKAAMKDLDLEAGLEMPSSATGDNGDMGLFLEEAEKVKMEMGSIREILVKLQQANEETKSAHKPETLKSLRNTINVDIVTVLKKARSIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEHPEEEVIEKIISNGGEEFLGRAIEEHGQGKVAETVVEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDDIEHHVMNASQYVRDGTKDLKTAKDLQRNSRKCMCFGIFLLLLIILVVVIPIAVSFGSS 309
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 19000785 19001789 + ClG42_04g0056600.10 Clacu04g0566 246963

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Clacu04g0566 309 CDD SNARE_syntaxin1-like 210 272 - -
Clacu04g0566 309 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 39 169 - -
Clacu04g0566 309 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 211 273 IPR000727 -
Clacu04g0566 309 SMART SynN_4 37 163 IPR006011 GO:0016020(InterPro)
Clacu04g0566 309 Gene3D - 37 166 - -
Clacu04g0566 309 FunFam Syntaxin 132 204 304 - -
Clacu04g0566 309 Gene3D - 204 307 - -
Clacu04g0566 309 SMART tSNARE_6 206 273 IPR000727 -
Clacu04g0566 309 CDD SynN 42 198 IPR006011 GO:0016020(InterPro)
Clacu04g0566 309 ProSitePatterns Syntaxin / epimorphin family signature. 217 257 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Clacu04g0566 309 Pfam SNARE domain 248 299 IPR000727 -
Clacu04g0566 309 SUPERFAMILY t-snare proteins 41 266 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Clacu04g0566 309 Coils Coil 137 157 - -
Clacu04g0566 309 PANTHER SYNTAXIN 48 294 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Clacu04g0566 309 Pfam Syntaxin 45 246 IPR006011 GO:0016020(InterPro)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Clacu04g0566 K08486 - - csv:101220775 563.918
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Clacu04g0566 Clacu-Chr4:19000785 Clacu10g1804 Clacu-Chr10:31661178 7.40E-59 dispersed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Clacu08g1440 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.0e-84 309.7
Clacu04g0566 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 3.5e-101 365.2
Clacu01g2023 . 516 817 SNARE and Associated Proteins AT2G18260 54.4 9.2e-86 313.9
Clacu10g1804 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.3e-115 411.8
Clacu01g1572 . 26 282 SNARE and Associated Proteins AT3G11820 72.8 8.5e-103 370.5
Clacu03g0558 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.0e-92 337.0
Clacu10g1344 . 30 284 SNARE and Associated Proteins AT3G11820 52.5 4.7e-69 258.5
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.6e-92 334.7
Clacu01g1572 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.3e-85 312.8
Clacu03g0558 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.9e-108 388.7
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 1.5e-83 306.6
Clacu01g1572 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 3.7e-79 292.0
Clacu10g1344 . 1 284 SNARE and Associated Proteins AT4G03330 52.1 7.8e-69 257.7
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.6e-128 453.4
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT1G61290 63.1 4.2e-91 331.6
Clacu01g1572 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.6e-85 313.2
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 3.4e-93 338.6
Clacu01g1572 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 1.1e-86 317.0
Clacu10g1344 . 1 303 SNARE and Associated Proteins AT3G03800 73.9 4.7e-114 407.9
Clacu02g0875 . 41 327 SNARE and Associated Proteins AT3G03800 55.6 2.0e-80 296.2
Clacu10g1344 . 1 202 SNARE and Associated Proteins AT5G08080 78.8 1.4e-80 296.2
Clacu02g0875 . 27 227 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Clacu10g0141 . 1 253 SNARE and Associated Proteins AT5G16830 59.5 1.9e-74 276.2
Clacu10g0141 . 1 253 SNARE and Associated Proteins AT5G46860 66.0 9.6e-79 290.4
Clacu10g0141 . 1 242 SNARE and Associated Proteins AT4G17730 63.2 4.5e-73 271.6
Clacu10g0141 . 65 253 SNARE and Associated Proteins AT1G32270 59.8 1.1e-50 197.6
Clacu07g0410 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 3.1e-111 398.7
Clacu08g1440 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.0e-84 309.7
Clacu02g1560 . 32 358 SNARE and Associated Proteins AT5G26980 76.8 4.6e-128 454.5
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT5G26980 66.2 2.5e-102 369.0
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 1.1e-105 380.2
Clacu02g1560 . 32 360 SNARE and Associated Proteins AT4G02195 64.4 3.2e-105 378.6
Clacu02g1560 . 32 359 SNARE and Associated Proteins AT3G05710 76.3 3.9e-130 461.5
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT3G05710 63.7 1.0e-98 357.1
Clacu09g1107 . 84 316 SNARE and Associated Proteins AT1G16240 72.1 2.3e-89 325.5
Clacu10g0465 . 905 1137 SNARE and Associated Proteins AT1G16240 67.8 3.2e-83 305.1
Clacu09g1107 . 83 316 SNARE and Associated Proteins AT1G79590 71.4 3.8e-88 321.6
Clacu10g0465 . 900 1137 SNARE and Associated Proteins AT1G79590 67.2 1.5e-84 309.7
Clacu06g0052 . 168 358 SNARE and Associated Proteins AT1G28490 71.7 8.2e-67 250.4
Clacu10g2011 . 1 264 SNARE and Associated Proteins AT3G09740 79.7 2.6e-113 405.2
Clacu02g2162 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 9.4e-95 343.6
Clacu02g2162 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.5e-92 334.0
Clacu10g2011 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 8.6e-88 320.5
Clacu10g2011 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 7.1e-95 344.0
Clacu02g2162 . 1 262 SNARE and Associated Proteins AT3G61450 61.0 1.9e-84 309.3
Clacu11g0790 . 65 290 SNARE and Associated Proteins AT1G51740 69.3 1.1e-78 290.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32