Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Clacu10g1804 ATGAACGATTTATTCTCCTCTCGATCCTTTTCCCGCGACACCCATGTCGTTGAAATGGGCAACGCTTCCTCTTCCCCTACTGCTGTTAATCTCGACAAGTTCTTTGAAGATGTTGAATCTGTTAAAGACGAGCTCAAGGAGCTTGAGCGACTCTACACTAACCTCCGTGACTCCCATGAACAGAGCAAGACCCTTCACAATGCTAAGGCCGTCAAGGACCTCCGATCTCGCATGGATTCTGATGTTTCTCTTGCTCTCAAGAAGGCCAAGCTCATTAAAGTCCGATTGGAGGCTCTTGATCGCTCCAATGCTGCCAACCGGAGTCTCCCTGGTTGCGGTCCCGGTTCCTCTTCTGACCGGACTCGGACTTCTGTAGTCAACGGTTTGAGGAAGAAATTGCAGGACTCAATGGAGAGTTTCAATAATCTCAGGCAACAGATCTCCTCTGAGTACCGGGAGACCGTTCAGCGAAGATATTACACGGTTACTGGGGAAAATCCGGACGAGAAGACCATTGATGTACTGATATCTACAGGTGAAAGTGAGACATTTTTGCAGAAAGCCATTCAAGAACAAGGTAGAGGCAGAATTCTAGACACCATTAGTGAGATCCAGGAGAGGCATGATGCTGTAAAAGACCTGGAAAGGAACCTCAAAGAGCTGCACCAGGTTTTCTTGGACATGGCAGTCTTGGTGCATGAGCAAGGCGAGAAACTTGACGACATCGAAAGCCAAGTGAACAGGGCTCATTCTTTTGTTCGAGGCGGCACGCAGGAGTTGACAACAGCTAGAGTATACCAGAAAAACACCCGGAAATGGACAATTATTGCCATCATCATTGTGCTGCTCATTGTCATGGTGATTGTCCTCAGCCTGCAGCCTTGGAAGAAAAACAACAGTGGACCCTAA 909 47.96 MNDLFSSRSFSRDTHVVEMGNASSSPTAVNLDKFFEDVESVKDELKELERLYTNLRDSHEQSKTLHNAKAVKDLRSRMDSDVSLALKKAKLIKVRLEALDRSNAANRSLPGCGPGSSSDRTRTSVVNGLRKKLQDSMESFNNLRQQISSEYRETVQRRYYTVTGENPDEKTIDVLISTGESETFLQKAIQEQGRGRILDTISEIQERHDAVKDLERNLKELHQVFLDMAVLVHEQGEKLDDIESQVNRAHSFVRGGTQELTTARVYQKNTRKWTIIAIIIVLLIVMVIVLSLQPWKKNNSGP 302
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
10 31661178 31662819 - ClG42_10g0180400.10 Clacu10g1804 260428

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Clacu10g1804 302 SMART SynN_4 26 152 IPR006011 GO:0016020(InterPro)
Clacu10g1804 302 Pfam Syntaxin 33 236 IPR006011 GO:0016020(InterPro)
Clacu10g1804 302 FunFam Syntaxin 132 194 293 - -
Clacu10g1804 302 CDD SNARE_syntaxin1-like 200 262 - -
Clacu10g1804 302 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 28 158 - -
Clacu10g1804 302 SMART tSNARE_6 196 263 IPR000727 -
Clacu10g1804 302 Gene3D - 197 293 - -
Clacu10g1804 302 Pfam SNARE domain 237 289 IPR000727 -
Clacu10g1804 302 SUPERFAMILY t-snare proteins 30 256 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Clacu10g1804 302 CDD SynN 31 188 IPR006011 GO:0016020(InterPro)
Clacu10g1804 302 Gene3D - 29 161 - -
Clacu10g1804 302 PANTHER SYNTAXIN 33 280 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Clacu10g1804 302 Coils Coil 204 224 - -
Clacu10g1804 302 Coils Coil 126 150 - -
Clacu10g1804 302 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 201 263 IPR000727 -
Clacu10g1804 302 ProSitePatterns Syntaxin / epimorphin family signature. 207 246 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Clacu10g1804 302 Coils Coil 31 65 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Clacu10g1804 K08486 - - csv:101208931 552.747
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Clacu01g1572 Clacu-Chr1:27813200 Clacu10g1804 Clacu-Chr10:31661178 1.60E-111 dispersed
Clacu03g0558 Clacu-Chr3:5754090 Clacu10g1804 Clacu-Chr10:31661178 5.50E-91 dispersed
Clacu04g0566 Clacu-Chr4:19000785 Clacu10g1804 Clacu-Chr10:31661178 7.40E-59 dispersed
Clacu10g1344 Clacu-Chr10:26467118 Clacu10g1804 Clacu-Chr10:31661178 1.40E-65 dispersed
Clacu10g1804 Clacu-Chr10:31661178 Clacu01g2023 Clacu-Chr1:32113083 1.30E-47 dispersed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Clacu08g1440 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.0e-84 309.7
Clacu04g0566 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 3.5e-101 365.2
Clacu01g2023 . 516 817 SNARE and Associated Proteins AT2G18260 54.4 9.2e-86 313.9
Clacu10g1804 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.3e-115 411.8
Clacu01g1572 . 26 282 SNARE and Associated Proteins AT3G11820 72.8 8.5e-103 370.5
Clacu03g0558 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.0e-92 337.0
Clacu10g1344 . 30 284 SNARE and Associated Proteins AT3G11820 52.5 4.7e-69 258.5
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.6e-92 334.7
Clacu01g1572 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.3e-85 312.8
Clacu03g0558 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.9e-108 388.7
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 1.5e-83 306.6
Clacu01g1572 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 3.7e-79 292.0
Clacu10g1344 . 1 284 SNARE and Associated Proteins AT4G03330 52.1 7.8e-69 257.7
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.6e-128 453.4
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT1G61290 63.1 4.2e-91 331.6
Clacu01g1572 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.6e-85 313.2
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 3.4e-93 338.6
Clacu01g1572 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 1.1e-86 317.0
Clacu10g1344 . 1 303 SNARE and Associated Proteins AT3G03800 73.9 4.7e-114 407.9
Clacu02g0875 . 41 327 SNARE and Associated Proteins AT3G03800 55.6 2.0e-80 296.2
Clacu10g1344 . 1 202 SNARE and Associated Proteins AT5G08080 78.8 1.4e-80 296.2
Clacu02g0875 . 27 227 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Clacu10g0141 . 1 253 SNARE and Associated Proteins AT5G16830 59.5 1.9e-74 276.2
Clacu10g0141 . 1 253 SNARE and Associated Proteins AT5G46860 66.0 9.6e-79 290.4
Clacu10g0141 . 1 242 SNARE and Associated Proteins AT4G17730 63.2 4.5e-73 271.6
Clacu10g0141 . 65 253 SNARE and Associated Proteins AT1G32270 59.8 1.1e-50 197.6
Clacu07g0410 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 3.1e-111 398.7
Clacu08g1440 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.0e-84 309.7
Clacu02g1560 . 32 358 SNARE and Associated Proteins AT5G26980 76.8 4.6e-128 454.5
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT5G26980 66.2 2.5e-102 369.0
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 1.1e-105 380.2
Clacu02g1560 . 32 360 SNARE and Associated Proteins AT4G02195 64.4 3.2e-105 378.6
Clacu02g1560 . 32 359 SNARE and Associated Proteins AT3G05710 76.3 3.9e-130 461.5
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT3G05710 63.7 1.0e-98 357.1
Clacu09g1107 . 84 316 SNARE and Associated Proteins AT1G16240 72.1 2.3e-89 325.5
Clacu10g0465 . 905 1137 SNARE and Associated Proteins AT1G16240 67.8 3.2e-83 305.1
Clacu09g1107 . 83 316 SNARE and Associated Proteins AT1G79590 71.4 3.8e-88 321.6
Clacu10g0465 . 900 1137 SNARE and Associated Proteins AT1G79590 67.2 1.5e-84 309.7
Clacu06g0052 . 168 358 SNARE and Associated Proteins AT1G28490 71.7 8.2e-67 250.4
Clacu10g2011 . 1 264 SNARE and Associated Proteins AT3G09740 79.7 2.6e-113 405.2
Clacu02g2162 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 9.4e-95 343.6
Clacu02g2162 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.5e-92 334.0
Clacu10g2011 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 8.6e-88 320.5
Clacu10g2011 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 7.1e-95 344.0
Clacu02g2162 . 1 262 SNARE and Associated Proteins AT3G61450 61.0 1.9e-84 309.3
Clacu11g0790 . 65 290 SNARE and Associated Proteins AT1G51740 69.3 1.1e-78 290.0
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62