Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Clacu11g0790 ATGGCGAAGTTCAGGGATAGGACTGAAGATTTTAAAGATGTTGTGCGGCACTGTGCTATTTCGTTAGGGTACAATGAGTCCAAGTTGGCGGTTATTATGGCATCTTTCATCATTCAGAAACCGCGGCAAAGGTCACCTTTCATCAAAGCTGCCCTGAAAACGCTTGAAAGCATTGGTGCTCTTGAAGAGTTTATGTTGAAACATCAAAAGGACTATGTAGATATGTATCGCACGACAGATCAAGAGAGAGACAATATTGAACACGAGGTAACTGCCTTCATCAAAGCATGCCAAGAACAACTTGATATCCTAAAAAACAGCATTAACGCGGATGATGCACACTCAAAGGGATGGCGTGGTCGTAGCACTGATGATTCTAATGCTGATACTATTGCACACAAACATGGGGTGGTTCTAATTTTGAGTGAGAAACTCCATTCGGTAACATCACAATTTGATAAGCTAAGAGCCATTCGGTTTCAAGATATCATAAGCAAAGCAGTACCAAGAAGAAAACTGAACCAAGTAAATAAACCACGTTCTGCCAATGCCCCTGAGTATAGTAATACAGAGCTGAGGGAACCTGATGATAATTTTGAGCATCAACCTGTCCGAGCCCAACAACTGTTGGATGATGAAACTCGTGCACTTCAGGTTGAGTTGACTAGTCTTCTTGACACAGTCCAAGAAACAGAAACTAAGATGGTAGAGATGTCTGCTCTAAATCACCTTATGTCTACACACGTTTTGCAGCAAGCACAACAAATTGAACATCTTTATGAACAGGCTGTTGAAGCTACGAAGAATGTCGAGCTTGGTAATAAAGAACTTACCCAAGCAATTCAGCGGAATAGCAACTCAAATAGTTACAATGTAAGTGGATTCCGAGGAGTGAACCATCTGCCACTTCAATTTCTCGAAGTTCCCTGCATTTTAGTTGCTGGAGCATGA 951 41.64 MAKFRDRTEDFKDVVRHCAISLGYNESKLAVIMASFIIQKPRQRSPFIKAALKTLESIGALEEFMLKHQKDYVDMYRTTDQERDNIEHEVTAFIKACQEQLDILKNSINADDAHSKGWRGRSTDDSNADTIAHKHGVVLILSEKLHSVTSQFDKLRAIRFQDIISKAVPRRKLNQVNKPRSANAPEYSNTELREPDDNFEHQPVRAQQLLDDETRALQVELTSLLDTVQETETKMVEMSALNHLMSTHVLQQAQQIEHLYEQAVEATKNVELGNKELTQAIQRNSNSNSYNVSGFRGVNHLPLQFLEVPCILVAGA 316
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
11 7789654 7792728 - ClG42_11g0079000.10 Clacu11g0790 261667

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Clacu11g0790 316 PANTHER SYNTAXIN-18 1 290 - GO:0005783(PANTHER)|GO:0006890(PANTHER)|GO:0031201(PANTHER)
Clacu11g0790 316 SUPERFAMILY t-snare proteins 61 273 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Clacu11g0790 316 MobiDBLite consensus disorder prediction 174 198 - -
Clacu11g0790 316 Pfam SNARE-complex protein Syntaxin-18 N-terminus 5 86 IPR019529 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Clacu11g0790 K08492 - - csv:101207161 539.265
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi13g422 . . . . . . . . . . . . . . Sed03g0404 Cpe13g01079 . Bhi04g02346 Tan11g0243 Cmetu03g1342 . Hepe02g3337 . Lcy10g2218 . . . . . . . . . . Cone18ag0421 Lsi03g00333 Csa06g00159 . . . . . . . . . . . Cmo04g03046 Cmo15g00129 Cma04g02924 Cma15g00119 Car04g02811 Car15g00129 . Cpe01g02531 . . . . . . . Cla11g00615 Cam11g0668 Cec11g0667 Cco11g0653 Clacu11g0790 Cmu11g0646 Cre11g1122 . . Chy03g00164 Cme03g00216
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Clacu08g1440 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.0e-84 309.7
Clacu04g0566 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 3.5e-101 365.2
Clacu01g2023 . 516 817 SNARE and Associated Proteins AT2G18260 54.4 9.2e-86 313.9
Clacu10g1804 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.3e-115 411.8
Clacu01g1572 . 26 282 SNARE and Associated Proteins AT3G11820 72.8 8.5e-103 370.5
Clacu03g0558 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.0e-92 337.0
Clacu10g1344 . 30 284 SNARE and Associated Proteins AT3G11820 52.5 4.7e-69 258.5
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.6e-92 334.7
Clacu01g1572 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.3e-85 312.8
Clacu03g0558 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.4e-81 298.9
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 2.9e-108 388.7
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 1.5e-83 306.6
Clacu01g1572 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 3.7e-79 292.0
Clacu10g1344 . 1 284 SNARE and Associated Proteins AT4G03330 52.1 7.8e-69 257.7
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.6e-128 453.4
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT1G61290 63.1 4.2e-91 331.6
Clacu01g1572 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.6e-85 313.2
Clacu03g0558 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Clacu10g1804 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 3.4e-93 338.6
Clacu01g1572 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 1.1e-86 317.0
Clacu10g1344 . 1 303 SNARE and Associated Proteins AT3G03800 73.9 4.7e-114 407.9
Clacu02g0875 . 41 327 SNARE and Associated Proteins AT3G03800 55.6 2.0e-80 296.2
Clacu10g1344 . 1 202 SNARE and Associated Proteins AT5G08080 78.8 1.4e-80 296.2
Clacu02g0875 . 27 227 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Clacu10g0141 . 1 253 SNARE and Associated Proteins AT5G16830 59.5 1.9e-74 276.2
Clacu10g0141 . 1 253 SNARE and Associated Proteins AT5G46860 66.0 9.6e-79 290.4
Clacu10g0141 . 1 242 SNARE and Associated Proteins AT4G17730 63.2 4.5e-73 271.6
Clacu10g0141 . 65 253 SNARE and Associated Proteins AT1G32270 59.8 1.1e-50 197.6
Clacu07g0410 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 3.1e-111 398.7
Clacu08g1440 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.0e-84 309.7
Clacu02g1560 . 32 358 SNARE and Associated Proteins AT5G26980 76.8 4.6e-128 454.5
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT5G26980 66.2 2.5e-102 369.0
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 1.1e-105 380.2
Clacu02g1560 . 32 360 SNARE and Associated Proteins AT4G02195 64.4 3.2e-105 378.6
Clacu02g1560 . 32 359 SNARE and Associated Proteins AT3G05710 76.3 3.9e-130 461.5
Clacu09g0546 . 1 318 SNARE and Associated Proteins AT3G05710 63.7 1.0e-98 357.1
Clacu09g1107 . 84 316 SNARE and Associated Proteins AT1G16240 72.1 2.3e-89 325.5
Clacu10g0465 . 905 1137 SNARE and Associated Proteins AT1G16240 67.8 3.2e-83 305.1
Clacu09g1107 . 83 316 SNARE and Associated Proteins AT1G79590 71.4 3.8e-88 321.6
Clacu10g0465 . 900 1137 SNARE and Associated Proteins AT1G79590 67.2 1.5e-84 309.7
Clacu06g0052 . 168 358 SNARE and Associated Proteins AT1G28490 71.7 8.2e-67 250.4
Clacu10g2011 . 1 264 SNARE and Associated Proteins AT3G09740 79.7 2.6e-113 405.2
Clacu02g2162 . 1 265 SNARE and Associated Proteins AT3G09740 67.4 9.4e-95 343.6
Clacu02g2162 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.5e-92 334.0
Clacu10g2011 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 8.6e-88 320.5
Clacu10g2011 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 7.1e-95 344.0
Clacu02g2162 . 1 262 SNARE and Associated Proteins AT3G61450 61.0 1.9e-84 309.3
Clacu11g0790 . 65 290 SNARE and Associated Proteins AT1G51740 69.3 1.1e-78 290.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0011407 0 1 0 1 0 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 2 1 1 1 30