Cucurbitales platform

Gene search

Sequence information

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Cma03g00248	ATGAACGACTTGATGACCAAATCGTTCACGAGCTATGTCGATTTGAAGAAGGCCGCCATGAAAGATATCGACCTCGAAGCCGGTTTAGAAATGGCATCGTCCGCTCCCGGCGACAATGGCGACATGGGTCTCTTTCTCGAAGAGGCCGAGAAGGTGAAAACCGAGATGGGTTCGATTAGAGAGATTTTATTGAAGCTTCAACAAGCCAATGAAGAGACCAAATCGGCTCATAAACCTGAAACCCTCAAATCGCTTCGGAATACGATCAATATCGACATTGTAACAGTTCTGAAAAAGGCTCGATCCATCCGATCCCACCTCGAGGAAATGGACCGTGCCAATGCTGCAAAGAAACGTCTCTCGGGTAGTAAAGAGGGCACTGCCATTTACAGAACACGAATTGCGGTGACGAACGGATTACGAAAGAAGCTAAAGGAGCTGATGATGGAGTTTCAGAGCTTGAGGCAGAGGATGATGACGGAGTATAAGGAGACGGTAGGACGGCGATACTTTACAGTGACGGGGGAGAAGGCGAATGAGGAGGTGATAGAGAAGATAATATCGGATGGCGTGGAGGAGTTTTTGGGGAGGGTGATAAAGGAGCACGGGCAAGGGGGGAAGGTGGTGGTGGCGGAGACGGTGGAGGAGATACAGGACCGACACGGGGCGGCGAAGGAGATAGAGAAGAGCTTGTTGGAGCTGCACCAAGTGTTCTTGGACATGGCGGTGATGGTGGAGGCACAAGGGGAGAAGATGGATAACATAGAACATCATGTGATGAATGCTTCGCAGTATGTTAGGGATGGAACAAAGGAATTGAAGAGTGCTAAGGAATTGCAAAGGAGTAGTAGGAAATGTATGTGTTTGGGGATTTTGCTATTGCTTTTGATTATTTTGGTTGTTGTTGTTCCTATTGGTGTTAGTTTTGGAAGTTCTTGA	939	47.92	MNDLMTKSFTSYVDLKKAAMKDIDLEAGLEMASSAPGDNGDMGLFLEEAEKVKTEMGSIREILLKLQQANEETKSAHKPETLKSLRNTINIDIVTVLKKARSIRSHLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEKANEEVIEKIISDGVEEFLGRVIKEHGQGGKVVVAETVEEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDNIEHHVMNASQYVRDGTKELKSAKELQRSSRKCMCLGILLLLLIILVVVVPIGVSFGSS	312

Gff information

Chromosome	Start	End	Strand	Old_gene	Gene	Num
3	3546408	3547702	-	CmaCh03G002480.1	Cma03g00248	289819

Annotation

Seq ID	Length	Analysis	Description	Start	End	IPR	GO
Cma03g00248	312	ProSiteProfiles	t-SNARE coiled-coil homology domain profile.	214	276	IPR000727	-
Cma03g00248	312	PANTHER	SYNTAXIN-RELATED PROTEIN KNOLLE	4	305	-	-
Cma03g00248	312	SMART	SynN_4	37	163	IPR006011	GO:0016020
Cma03g00248	312	CDD	SNARE_syntaxin1-like	213	274	-	-
Cma03g00248	312	CDD	SynN	42	195	IPR006011	GO:0016020
Cma03g00248	312	Pfam	Syntaxin	45	249	IPR006011	GO:0016020
Cma03g00248	312	PANTHER	SYNTAXIN	4	305	IPR045242	-
Cma03g00248	312	Pfam	SNARE domain	251	302	IPR000727	-
Cma03g00248	312	ProSitePatterns	Syntaxin / epimorphin family signature.	220	260	IPR006012	GO:0005484\|GO:0006886\|GO:0016020
Cma03g00248	312	Gene3D	-	210	310	-	-
Cma03g00248	312	Gene3D	-	38	166	-	-
Cma03g00248	312	SMART	tSNARE_6	209	276	IPR000727	-
Cma03g00248	312	SUPERFAMILY	t-snare proteins	41	269	IPR010989	GO:0016020\|GO:0016192
Cma03g00248	312	Coils	Coil	137	157	-	-

Pathway

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Cma03g00248	K08486	STX1B_2_3; syntaxin 1B/2/3	-	csv:101220775	495.738

Dupl-types

Gene1	Location1	Gene2	Location2	E-value	Duplicated-type
Cma03g00248	Cma-Chr3:3546408	Cma13g00676	Cma-Chr13:6245413	1.23E-89	dispersed
Cma03g00740	Cma-Chr3:5887631	Cma03g00248	Cma-Chr3:3546408	5.97E-68	transposed
Cma03g00248	Cma-Chr3:3546408	Cma07g01172	Cma-Chr7:6428287	5.18E-176	wgd

Deco-Alignment

Select	Vvi1	Blo1	Blo2	Bda1	Bda2	Bpe1	Bpe2	Bma1	Bma2	Cmo1	Cmo2	Cma1	Cma2	Car1	Car2	Sed1	Cpe1	Cpe2	Bhi1	Tan1	Cmetu1	Lac1	Hepe1	Mch1	Lcy1	Cla1	Cam1	Cec1	Cco1	Clacu1	Cmu1	Cre1	Cone1	Cone2	Cone3	Cone4	Lsi1	Csa1	Chy1	Cme1	Blo3	Blo4	Bda3	Bda4	Bpe3	Bpe4	Bma3	Bma4	Sed2	Cmo3	Cmo4	Cma3	Cma4	Car3	Car4	Cpe3	Cpe4	Bhi2	Tan2	Cmetu2	Lac2	Hepe2	Mch2	Lcy2	Cla2	Cam2	Cec2	Cco2	Clacu2	Cmu2	Cre2	Lsi2	Csa2	Chy2	Cme2
	Vvi8g156	.	.	.	.	.	.	.	.	.	.	Cma03g00248	.	Car03g00212	.	Sed14g0695	Cpe10g01038	Cpe08g00962	Bhi03g02299	Tan03g0640	Cmetu08g0109	.	Hepe04g0635	.	.	.	.	.	.	.	.	.	Cone3ag0557	Cone10ag0552	Cone13ag0475	.	Lsi01g01659	Csa04g01137	.	Cme04g01796	.	.	.	.	.	.	.	.	.	Cmo03g00262	Cmo07g01220	.	.	.	.	.	.	Bhi11g01551	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	Cme08g02007

Syn-Families

Gene	Event_type	S_start	S_end	Function	Ath_gene	Identity(%)	E-value	Score
Cma05g00643	.	22	353	SNARE and Associated Proteins	AT3G24350	65.1	2.7e-103	372.9
Cma12g00301	.	443	750	SNARE and Associated Proteins	AT3G24350	62.3	3.1e-91	332.8
Cma07g01172	.	1	308	SNARE and Associated Proteins	AT1G08560	67.5	1.5e-99	360.1
Cma03g00248	.	1	312	SNARE and Associated Proteins	AT1G08560	67.7	3.0e-95	345.9
Cma03g00740	.	1	303	SNARE and Associated Proteins	AT2G18260	53.4	2.6e-83	306.2
Cma14g00365	.	1330	1590	SNARE and Associated Proteins	AT3G11820	80.8	4.6e-115	411.8
Cma06g00530	.	19	264	SNARE and Associated Proteins	AT3G11820	72.4	1.9e-100	363.2
Cma07g00822	.	21	278	SNARE and Associated Proteins	AT3G11820	69.4	1.7e-98	356.7
Cma18g00344	.	31	281	SNARE and Associated Proteins	AT3G11820	67.3	2.6e-94	342.8
Cma13g00676	.	31	281	SNARE and Associated Proteins	AT3G11820	66.1	2.1e-91	333.2
Cma14g01106	.	67	325	SNARE and Associated Proteins	AT3G11820	52.1	6.5e-69	258.5
Cma14g00365	.	1312	1590	SNARE and Associated Proteins	AT3G52400	63.9	2.0e-92	336.7
Cma07g00822	.	1	277	SNARE and Associated Proteins	AT3G52400	59.4	2.6e-84	309.7
Cma13g00676	.	1	281	SNARE and Associated Proteins	AT3G52400	56.5	2.7e-81	299.7
Cma06g00530	.	14	264	SNARE and Associated Proteins	AT3G52400	60.7	8.8e-80	294.7
Cma18g00344	.	1	281	SNARE and Associated Proteins	AT3G52400	55.3	1.5e-79	293.9
Cma14g01106	.	77	325	SNARE and Associated Proteins	AT3G52400	50.2	4.5e-60	229.2
Cma18g00344	.	1	295	SNARE and Associated Proteins	AT4G03330	69.8	9.9e-107	384.0
Cma13g00676	.	1	299	SNARE and Associated Proteins	AT4G03330	67.5	1.3e-106	383.6
Cma14g00365	.	1312	1591	SNARE and Associated Proteins	AT4G03330	57.7	9.9e-83	304.3
Cma07g00822	.	1	278	SNARE and Associated Proteins	AT4G03330	52.7	2.0e-75	280.0
Cma06g00530	.	1	269	SNARE and Associated Proteins	AT4G03330	54.1	1.3e-74	277.3
Cma14g01106	.	77	325	SNARE and Associated Proteins	AT4G03330	55.4	1.8e-68	256.9
Cma18g00344	.	1	303	SNARE and Associated Proteins	AT1G61290	78.9	2.6e-128	455.7
Cma13g00676	.	1	303	SNARE and Associated Proteins	AT1G61290	77.2	7.2e-126	447.6
Cma14g00365	.	1312	1591	SNARE and Associated Proteins	AT1G61290	61.0	7.1e-89	324.7
Cma06g00530	.	1	279	SNARE and Associated Proteins	AT1G61290	56.4	1.5e-83	307.0
Cma07g00822	.	1	296	SNARE and Associated Proteins	AT1G61290	54.4	6.4e-82	301.6
Cma14g01106	.	75	325	SNARE and Associated Proteins	AT1G61290	51.0	4.6e-64	242.3
Cma18g00344	.	1	303	SNARE and Associated Proteins	AT1G11250	78.2	3.2e-126	448.7
Cma13g00676	.	1	303	SNARE and Associated Proteins	AT1G11250	76.6	4.3e-123	438.3
Cma14g00365	.	1312	1591	SNARE and Associated Proteins	AT1G11250	61.8	3.9e-92	335.5
Cma06g00530	.	1	279	SNARE and Associated Proteins	AT1G11250	57.5	3.2e-86	315.8
Cma07g00822	.	1	291	SNARE and Associated Proteins	AT1G11250	55.0	3.3e-83	305.8
Cma14g01106	.	60	325	SNARE and Associated Proteins	AT1G11250	51.1	8.8e-68	254.6
Cma14g01106	.	48	344	SNARE and Associated Proteins	AT3G03800	74.4	1.9e-113	406.4
Cma20g00629	.	1	270	SNARE and Associated Proteins	AT3G03800	57.3	4.5e-75	278.9
Cma14g01106	.	48	243	SNARE and Associated Proteins	AT5G08080	77.6	7.0e-78	287.7
Cma20g00629	.	1	204	SNARE and Associated Proteins	AT5G08080	58.8	1.6e-53	206.8
Cma06g00638	CST	1	256	SNARE and Associated Proteins	AT5G16830	59.9	1.1e-75	280.8
Cma16g01176	CST	1	256	SNARE and Associated Proteins	AT5G16830	59.9	1.1e-75	280.8
Cma06g00638	CST	1	256	SNARE and Associated Proteins	AT5G46860	66.8	2.8e-81	299.3
Cma16g01176	CST	1	256	SNARE and Associated Proteins	AT5G46860	66.8	1.8e-80	296.6
Cma06g00638	CST	1	256	SNARE and Associated Proteins	AT4G17730	61.3	3.2e-74	275.8
Cma16g01176	CST	1	256	SNARE and Associated Proteins	AT4G17730	61.7	9.5e-74	274.2
Cma16g01176	CST	65	256	SNARE and Associated Proteins	AT1G32270	60.9	7.0e-53	205.3
Cma06g00638	CST	65	256	SNARE and Associated Proteins	AT1G32270	60.4	1.3e-51	201.1
Cma04g01124	CST	1	334	SNARE and Associated Proteins	AT5G05760	66.0	8.6e-112	401.0
Cma04g00161	CST	1	334	SNARE and Associated Proteins	AT5G05760	60.9	1.6e-102	370.2
Cma05g00643	.	22	353	SNARE and Associated Proteins	AT3G24350	65.1	2.7e-103	372.9
Cma12g00301	.	443	750	SNARE and Associated Proteins	AT3G24350	62.3	3.1e-91	332.8
Cma12g01045	CST	1	327	SNARE and Associated Proteins	AT5G26980	74.9	6.5e-125	444.5
Cma05g01087	CST	1	318	SNARE and Associated Proteins	AT5G26980	75.5	2.3e-122	436.0
Cma17g01060	.	1	320	SNARE and Associated Proteins	AT5G26980	65.2	8.5e-101	364.4
Cma12g01045	CST	1	329	SNARE and Associated Proteins	AT4G02195	63.1	1.6e-102	370.2
Cma05g01087	CST	1	318	SNARE and Associated Proteins	AT4G02195	63.0	3.5e-102	369.0
Cma17g01060	.	1	320	SNARE and Associated Proteins	AT4G02195	64.4	2.9e-101	365.9
Cma12g01045	CST	1	328	SNARE and Associated Proteins	AT3G05710	73.9	1.2e-126	450.3
Cma05g01087	CST	1	318	SNARE and Associated Proteins	AT3G05710	74.6	1.5e-124	443.4
Cma17g01060	.	1	320	SNARE and Associated Proteins	AT3G05710	63.4	2.4e-98	356.3
Cma01g01111	CCT,CST	1	233	SNARE and Associated Proteins	AT1G16240	73.4	3.4e-91	332.0
Cma09g00975	CCT,CST	66	294	SNARE and Associated Proteins	AT1G16240	70.4	6.2e-85	311.2
Cma16g00924	CCT	3	188	SNARE and Associated Proteins	AT1G16240	53.7	6.0e-56	214.9
Cma01g01111	CCT,CST	1	233	SNARE and Associated Proteins	AT1G79590	73.0	1.9e-90	329.7
Cma09g00975	CCT,CST	51	294	SNARE and Associated Proteins	AT1G79590	68.7	5.4e-85	311.6
Cma16g00924	CCT	2	188	SNARE and Associated Proteins	AT1G79590	53.7	1.4e-56	217.2
Cma01g00944	.	5	199	SNARE and Associated Proteins	AT1G28490	69.7	1.9e-66	249.6
Cma17g00042	.	162	352	SNARE and Associated Proteins	AT1G28490	70.2	1.8e-64	243.0
Cma14g00203	.	1	261	SNARE and Associated Proteins	AT3G09740	77.6	2.4e-109	392.5
Cma01g01054	.	1	261	SNARE and Associated Proteins	AT3G09740	77.6	9.2e-109	390.6
Cma02g00885	.	1	264	SNARE and Associated Proteins	AT3G09740	67.5	4.9e-94	341.7
Cma01g01054	.	1	261	SNARE and Associated Proteins	AT3G45280	64.0	2.2e-86	316.2
Cma02g00885	.	1	264	SNARE and Associated Proteins	AT3G45280	63.8	3.8e-86	315.5
Cma14g00203	.	1	261	SNARE and Associated Proteins	AT3G45280	63.6	1.4e-85	313.5
Cma01g01054	.	1	261	SNARE and Associated Proteins	AT3G61450	69.3	2.0e-95	346.3
Cma14g00203	.	1	261	SNARE and Associated Proteins	AT3G61450	68.6	4.3e-95	345.1
Cma02g00885	.	1	261	SNARE and Associated Proteins	AT3G61450	60.5	2.2e-83	306.2
Cma04g02924	CST	65	309	SNARE and Associated Proteins	AT1G51740	73.6	6.5e-93	337.8
Cma15g00119	CST	302	531	SNARE and Associated Proteins	AT1G51740	72.7	4.5e-86	315.1

Syn-Orthogroups

Select	Orthogroup	Bda	Bhi	Blo	Bma	Bpe	Cam	Car	Cco	Cec	Chy	Cla	Clacu	Cma	Cme	Cmetu	Cmo	Cmu	Cone	Cpe	Cre	Csa	HCH	Hepe	Lac	Lcy	Lsi	Mch	Sed	Tan	Vvi	Total
	OG0010730	0	1	0	0	0	1	2	1	1	1	1	1	2	1	1	2	1	2	2	1	1	1	1	1	1	1	1	2	1	1	32

Transcriptome

Select	Gene	Chr	Type	da1	da2	da3	da4	da5	da6	da7	da8	da9	da10
	Cma03g00248	Cma_Chr03	FPKM	18.112837	21.341158	0.901127	1.371916	59.646782	80.024948	60.750607	0.0	0.0	0.0