Cucurbitales platform

Gene search

Sequence information

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Cma11g01543	ATGGCCATCTCAGAATCTCAGACCCGTTCCTCTCTGATTCCTACTTTCCTCTACTCGTCTTCGGCCATTCCGTTCCAGAAGATGCTTCGCTCCAATGATCCTTGTGTATCGCCGTCGCCATCGCCATCTCCGATTGTCGAATCTACACCGAGGAAGGTCTTCGCGATTCCGTCTCCGAGTGAACCGAGAAAGAAACTGGAGATGTATTCGCCGGCTTTCTATGCTGCCTGTGCCTTCGGTGGAAGCCTCAGTTGTGGTCTCACTCACACGGCCGTCACTCCTCTCGATCTCATCAAGTGCAATATGCAGATTGACCCTGTGAAATACAAGAGCATTTCATCAGGTTTTGGAGTTCTTTTAAAGGAGCAAGGAATCAGGGGCTTCTTCAGGGGTTGGGCGCCAACTTTTCTGGGTTACAGTGCTCAGGGTGCTTGCAAGTATGGTATCTATGAATTCTTTAAGAAATACTATTCCGACATAGCTGGTCCAGAGTATGCAGCAAAGTACAAGACCTTGATCTATCTTGCTGGCTCTGCATCTGCTGAAGTGATTGCAGATGTTGCACTTTGCCCATTTGAAGCTGTTAAAGTTAGAGTTCAAACTCAGCCTGGTTTTGCTAGAGGTCTGTCAGATGGCCTTCCCAAATTCGTCAGATCTGAAGGTGCCCTGGGGTTGTACAAGGGTATTGTTCCTCTATGGGGGCGTCAGATCCCATATACAATGATGAAATTTGCAACATTTGAGAATCTCGTGGAGCTCATCTACAAGCATGTCATTCCCAAGCCAAAGAACGAATGCAGCAGCGCCTTGCAGCTGGGCGTCAGCTTTGCTGGTGGATATATTGCGGGAGTTTCTTGTGCTATAGTTTCTCACCCTGCAGACAATCTGGTCTCTTTTCTCAACAATGCTAAAGGGGCTACCGTTGGTGACGCTGTGAAGAAGCTTGGAGTATGGGGTCTCTTTACACGAGGGCTGCCTCTACGCATAGTCATGATTGGAACCCTCACTGGAGCTCAGTGGGTTATCTACGACGCATTCAAAGTTTTTGTCGGATTGCCAACTACCGGTGGGGTTGCCCCTGCCCCTGCCCCCGCCATTGAAATTCCAAGTGCGTAG	1116	49.1	MAISESQTRSSLIPTFLYSSSAIPFQKMLRSNDPCVSPSPSPSPIVESTPRKVFAIPSPSEPRKKLEMYSPAFYAACAFGGSLSCGLTHTAVTPLDLIKCNMQIDPVKYKSISSGFGVLLKEQGIRGFFRGWAPTFLGYSAQGACKYGIYEFFKKYYSDIAGPEYAAKYKTLIYLAGSASAEVIADVALCPFEAVKVRVQTQPGFARGLSDGLPKFVRSEGALGLYKGIVPLWGRQIPYTMMKFATFENLVELIYKHVIPKPKNECSSALQLGVSFAGGYIAGVSCAIVSHPADNLVSFLNNAKGATVGDAVKKLGVWGLFTRGLPLRIVMIGTLTGAQWVIYDAFKVFVGLPTTGGVAPAPAPAIEIPSA	371

Gff information

Chromosome	Start	End	Strand	Old_gene	Gene	Num
11	10063250	10067255	-	CmaCh11G015430.1	Cma11g01543	304052

Annotation

Seq ID	Length	Analysis	Description	Start	End	IPR	GO
Cma11g01543	371	PANTHER	SOLUTE CARRIER FAMILY 25 (MITOCHONDRIAL CARRIER PHOSPHATE CARRIER), MEMBER 3, LIKE-RELATED-RELATED	4	366	IPR044677	GO:0005315\|GO:1990547
Cma11g01543	371	SUPERFAMILY	Mitochondrial carrier	74	345	IPR023395	-
Cma11g01543	371	Pfam	Mitochondrial carrier protein	173	257	IPR018108	-
Cma11g01543	371	Pfam	Mitochondrial carrier protein	74	158	IPR018108	-
Cma11g01543	371	Gene3D	Mitochondrial carrier domain	51	164	IPR023395	-
Cma11g01543	371	Gene3D	Mitochondrial carrier domain	165	351	IPR023395	-
Cma11g01543	371	ProSiteProfiles	Solute carrier (Solcar) repeat profile.	169	253	IPR018108	-
Cma11g01543	371	ProSiteProfiles	Solute carrier (Solcar) repeat profile.	72	156	IPR018108	-
Cma11g01543	371	PANTHER	MITOCHONDRIAL PHOSPHATE TRANSPORTER	4	366	-	-

Pathway

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Cma11g01543	K15102	SLC25A3, PHC, PIC; solute carrier family 25 (mitochondrial phosphate transporter), member 3	-	csv:101203018	619.772

Dupl-types

Gene1	Location1	Gene2	Location2	E-value	Duplicated-type
Cma04g02217	Cma-Chr4:15459949	Cma11g01543	Cma-Chr11:10063250	0	dispersed
Cma11g01543	Cma-Chr11:10063250	Cma15g00816	Cma-Chr15:4108364	0	dispersed
Cma11g01327	Cma-Chr11:8803788	Cma11g01543	Cma-Chr11:10063250	4.15E-110	transposed
Cma10g00026	Cma-Chr10:98679	Cma11g01543	Cma-Chr11:10063250	0	wgd
Cma11g00008	Cma-Chr11:45311	Cma11g01543	Cma-Chr11:10063250	2.85E-30	wgd
Cma11g01543	Cma-Chr11:10063250	Cma14g00756	Cma-Chr14:3776396	3.90E-09	wgd

Deco-Alignment

Select	Vvi1	Blo1	Blo2	Bda1	Bda2	Bpe1	Bpe2	Bma1	Bma2	Cmo1	Cmo2	Cma1	Cma2	Car1	Car2	Sed1	Cpe1	Cpe2	Bhi1	Tan1	Cmetu1	Lac1	Hepe1	Mch1	Lcy1	Cla1	Cam1	Cec1	Cco1	Clacu1	Cmu1	Cre1	Cone1	Cone2	Cone3	Cone4	Lsi1	Csa1	Chy1	Cme1	Blo3	Blo4	Bda3	Bda4	Bpe3	Bpe4	Bma3	Bma4	Sed2	Cmo3	Cmo4	Cma3	Cma4	Car3	Car4	Cpe3	Cpe4	Bhi2	Tan2	Cmetu2	Lac2	Hepe2	Mch2	Lcy2	Cla2	Cam2	Cec2	Cco2	Clacu2	Cmu2	Cre2	Lsi2	Csa2	Chy2	Cme2
	Vvi14g1108	.	.	Bda01g01054	.	Bpe02g01298	.	.	.	.	Cmo11g01578	Cma11g01543	.	Car11g01274	.	.	.	Cpe13g00493	.	.	.	.	.	.	.	.	.	.	.	.	.	.	Cone11ag0021	Cone18ag1459	.	.	Lsi05g00457	.	.	.	.	Blo18g00547	.	.	.	.	Bma01g01227	.	.	Cmo04g02319	.	.	.	.	.	.	Cpe01g01926	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	Csa03g02562	.	.

Syn-Families

Gene	Event_type	S_start	S_end	Function	Ath_gene	Identity(%)	E-value	Score
Cma01g00591	.	1	407	Chloroplast and Mitochondria Gene Families	AT2G28800	65.1	4.0e-138	488.8
Cma05g00057	.	71	410	Chloroplast and Mitochondria Gene Families	AT2G28800	57.1	1.3e-99	360.9
Cma12g00046	.	71	423	Chloroplast and Mitochondria Gene Families	AT2G28800	52.9	7.2e-95	345.1
Cma15g00603	.	3	255	Chloroplast and Mitochondria Gene Families	AT1G15820	82.7	1.3e-120	429.9
Cma11g01642	.	3	255	Chloroplast and Mitochondria Gene Families	AT1G15820	82.0	3.0e-120	428.7
Cma19g00866	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	88.7	8.3e-143	503.8
Cma11g01288	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	88.7	8.3e-143	503.8
Cma01g00265	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	77.2	4.5e-120	428.3
Cma03g01380	CST	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	76.7	2.9e-119	425.6
Cma03g01381	CST	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	76.7	2.9e-119	425.6
Cma13g00541	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	77.0	3.8e-119	425.2
Cma07g00129	CST	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	76.7	4.9e-119	424.9
Cma07g00128	CST	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	76.7	4.9e-119	424.9
Cma02g00036	CST	3	269	Chloroplast and Mitochondria Gene Families	AT3G27690	76.2	6.4e-119	424.5
Cma20g00260	CST	2	267	Chloroplast and Mitochondria Gene Families	AT3G27690	76.3	1.9e-118	422.9
Cma14g00956	.	8	278	Chloroplast and Mitochondria Gene Families	AT3G27690	75.2	4.2e-118	421.8
Cma16g00808	.	5	264	Chloroplast and Mitochondria Gene Families	AT3G27690	66.8	1.8e-97	353.2
Cma04g00918	.	5	264	Chloroplast and Mitochondria Gene Families	AT3G27690	65.7	5.9e-96	348.2
Cma09g00012	.	113	329	Chloroplast and Mitochondria Gene Families	AT3G27690	52.1	1.2e-53	207.6
Cma01g00890	.	73	276	Chloroplast and Mitochondria Gene Families	AT3G27690	53.1	5.2e-52	202.2
Cma04g01836	.	3	262	Chloroplast and Mitochondria Gene Families	AT3G61470	81.7	4.0e-125	444.9
Cma18g00694	.	3	262	Chloroplast and Mitochondria Gene Families	AT3G61470	83.2	5.2e-125	444.5
Cma11g00746	.	60	262	Chloroplast and Mitochondria Gene Families	AT3G61470	65.5	4.4e-84	308.5
Cma11g00139	.	22	250	Chloroplast and Mitochondria Gene Families	AT3G61470	50.6	1.3e-62	237.3
Cma01g00793	.	270	493	Chloroplast and Mitochondria Gene Families	AT3G61470	50.2	1.1e-61	234.2
Cma15g00450	CST	1	198	Chloroplast and Mitochondria Gene Families	AT3G54890	81.6	5.0e-89	324.7
Cma04g02584	CST	1	198	Chloroplast and Mitochondria Gene Families	AT3G54890	79.9	9.4e-88	320.5
Cma03g00360	.	54	338	Chloroplast and Mitochondria Gene Families	AT3G08940	83.6	1.2e-135	479.9
Cma07g01046	CCT,CST	712	985	Chloroplast and Mitochondria Gene Families	AT3G08940	78.2	6.4e-124	441.0
Cma09g00012	.	3	336	Chloroplast and Mitochondria Gene Families	AT1G76570	71.0	6.1e-139	491.1
Cma11g01288	.	47	256	Chloroplast and Mitochondria Gene Families	AT1G76570	50.5	5.2e-53	205.7
Cma19g00866	.	47	256	Chloroplast and Mitochondria Gene Families	AT1G76570	50.5	6.7e-53	205.3
Cma11g00901	CCT	439	712	Chloroplast and Mitochondria Gene Families	AT1G61520	86.9	8.2e-137	483.8
Cma10g00869	.	1	257	Chloroplast and Mitochondria Gene Families	AT1G61520	84.8	3.2e-125	445.3
Cma19g00866	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G05070	89.1	5.7e-143	504.2
Cma11g01288	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G05070	88.7	1.7e-142	502.7
Cma03g01380	CST	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.6	8.8e-120	427.2
Cma03g01381	CST	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.6	8.8e-120	427.2
Cma13g00541	.	7	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.8	2.0e-119	426.0
Cma20g00260	CST	7	267	Chloroplast and Mitochondria Gene Families	AT2G05070	78.6	4.4e-119	424.9
Cma07g00129	CST	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	77.8	5.7e-119	424.5
Cma07g00128	CST	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	77.8	5.7e-119	424.5
Cma01g00265	.	8	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.8	2.2e-118	422.5
Cma02g00036	CST	8	269	Chloroplast and Mitochondria Gene Families	AT2G05070	77.8	2.8e-118	422.2
Cma14g00956	.	14	278	Chloroplast and Mitochondria Gene Families	AT2G05070	77.2	1.6e-116	416.4
Cma16g00808	.	7	264	Chloroplast and Mitochondria Gene Families	AT2G05070	67.8	2.8e-97	352.4
Cma04g00918	.	8	264	Chloroplast and Mitochondria Gene Families	AT2G05070	66.9	6.8e-96	347.8
Cma09g00012	.	113	329	Chloroplast and Mitochondria Gene Families	AT2G05070	51.6	3.5e-52	202.6
Cma01g00890	.	73	276	Chloroplast and Mitochondria Gene Families	AT2G05070	53.6	3.5e-52	202.6
Cma11g01288	.	1	237	Chloroplast and Mitochondria Gene Families	AT2G05100	89.0	8.3e-125	444.1
Cma19g00866	.	1	237	Chloroplast and Mitochondria Gene Families	AT2G05100	89.5	1.9e-124	443.0
Cma03g01380	CST	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	75.9	2.2e-101	366.3
Cma03g01381	CST	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	76.1	2.9e-101	365.9
Cma13g00541	.	7	237	Chloroplast and Mitochondria Gene Families	AT2G05100	77.1	6.4e-101	364.8
Cma07g00129	CST	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	75.9	1.4e-100	363.6
Cma07g00128	CST	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	75.9	1.4e-100	363.6
Cma01g00265	.	8	237	Chloroplast and Mitochondria Gene Families	AT2G05100	77.6	1.9e-100	363.2
Cma20g00260	CST	7	239	Chloroplast and Mitochondria Gene Families	AT2G05100	76.5	3.2e-100	362.5
Cma02g00036	CST	8	241	Chloroplast and Mitochondria Gene Families	AT2G05100	76.1	9.3e-100	360.9
Cma14g00956	.	14	250	Chloroplast and Mitochondria Gene Families	AT2G05100	75.8	1.3e-98	357.1
Cma16g00808	.	7	236	Chloroplast and Mitochondria Gene Families	AT2G05100	67.4	2.3e-82	303.1
Cma04g00918	.	8	236	Chloroplast and Mitochondria Gene Families	AT2G05100	66.4	7.4e-81	298.1
Cma09g00012	.	113	313	Chloroplast and Mitochondria Gene Families	AT2G05100	50.2	2.1e-43	173.7
Cma01g00890	.	73	260	Chloroplast and Mitochondria Gene Families	AT2G05100	51.8	3.6e-43	172.9
Cma03g00360	.	53	221	Chloroplast and Mitochondria Gene Families	AT2G40100	72.8	2.5e-68	255.8
Cma07g01046	CCT,CST	715	877	Chloroplast and Mitochondria Gene Families	AT2G40100	71.3	2.2e-64	242.7
Cma13g00541	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	88.0	8.9e-136	480.3
Cma20g00260	CST	1	267	Chloroplast and Mitochondria Gene Families	AT1G29930	87.7	9.8e-135	476.9
Cma03g01380	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	87.6	1.3e-134	476.5
Cma02g00036	CST	3	269	Chloroplast and Mitochondria Gene Families	AT1G29930	88.8	1.7e-134	476.1
Cma03g01381	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	87.6	2.2e-134	475.7
Cma07g00129	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	87.3	1.1e-133	473.4
Cma07g00128	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	87.3	1.1e-133	473.4
Cma01g00265	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29930	85.3	9.8e-127	450.3
Cma14g00956	.	16	278	Chloroplast and Mitochondria Gene Families	AT1G29930	83.1	7.0e-125	444.1
Cma19g00866	.	3	265	Chloroplast and Mitochondria Gene Families	AT1G29930	77.5	1.7e-115	412.9
Cma11g01288	.	3	265	Chloroplast and Mitochondria Gene Families	AT1G29930	77.9	1.9e-114	409.5
Cma04g00918	.	46	264	Chloroplast and Mitochondria Gene Families	AT1G29930	74.5	1.9e-93	339.7
Cma16g00808	.	46	264	Chloroplast and Mitochondria Gene Families	AT1G29930	74.5	1.9e-93	339.7
Cma01g00890	.	57	276	Chloroplast and Mitochondria Gene Families	AT1G29930	50.9	2.1e-52	203.4
Cma13g00541	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	87.6	3.4e-135	478.4
Cma20g00260	CST	1	267	Chloroplast and Mitochondria Gene Families	AT1G29920	87.3	3.7e-134	474.9
Cma03g01380	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	87.3	4.9e-134	474.6
Cma02g00036	CST	3	269	Chloroplast and Mitochondria Gene Families	AT1G29920	88.4	6.3e-134	474.2
Cma03g01381	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	87.3	8.3e-134	473.8
Cma07g00129	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	86.9	4.1e-133	471.5
Cma07g00128	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	86.9	4.1e-133	471.5
Cma01g00265	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29920	85.3	1.3e-126	449.9
Cma14g00956	.	16	278	Chloroplast and Mitochondria Gene Families	AT1G29920	83.1	9.2e-125	443.7
Cma19g00866	.	31	265	Chloroplast and Mitochondria Gene Families	AT1G29920	82.8	2.3e-115	412.5
Cma11g01288	.	31	265	Chloroplast and Mitochondria Gene Families	AT1G29920	83.3	2.5e-114	409.1
Cma04g00918	.	46	264	Chloroplast and Mitochondria Gene Families	AT1G29920	74.5	1.9e-93	339.7
Cma16g00808	.	46	264	Chloroplast and Mitochondria Gene Families	AT1G29920	74.5	1.9e-93	339.7
Cma01g00890	.	57	276	Chloroplast and Mitochondria Gene Families	AT1G29920	50.9	2.1e-52	203.4
Cma13g00541	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	87.6	3.4e-135	478.4
Cma20g00260	CST	1	267	Chloroplast and Mitochondria Gene Families	AT1G29910	87.3	3.7e-134	474.9
Cma03g01380	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	87.3	4.9e-134	474.6
Cma02g00036	CST	3	269	Chloroplast and Mitochondria Gene Families	AT1G29910	88.4	6.3e-134	474.2
Cma03g01381	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	87.3	8.3e-134	473.8
Cma07g00129	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	86.9	4.1e-133	471.5
Cma07g00128	CST	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	86.9	4.1e-133	471.5
Cma01g00265	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29910	85.3	1.3e-126	449.9
Cma14g00956	.	16	278	Chloroplast and Mitochondria Gene Families	AT1G29910	83.1	9.2e-125	443.7
Cma19g00866	.	31	265	Chloroplast and Mitochondria Gene Families	AT1G29910	82.8	2.3e-115	412.5
Cma11g01288	.	31	265	Chloroplast and Mitochondria Gene Families	AT1G29910	83.3	2.5e-114	409.1
Cma04g00918	.	46	264	Chloroplast and Mitochondria Gene Families	AT1G29910	74.5	1.9e-93	339.7
Cma16g00808	.	46	264	Chloroplast and Mitochondria Gene Families	AT1G29910	74.5	1.9e-93	339.7
Cma01g00890	.	57	276	Chloroplast and Mitochondria Gene Families	AT1G29910	50.9	2.1e-52	203.4
Cma01g00890	.	11	291	Chloroplast and Mitochondria Gene Families	AT4G10340	82.9	8.7e-134	473.8
Cma13g00541	.	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	51.6	8.6e-57	218.0
Cma03g01380	CST	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.5	8.6e-57	218.0
Cma03g01381	CST	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.5	8.6e-57	218.0
Cma14g00956	.	62	266	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	1.1e-56	217.6
Cma07g00129	CST	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.0	1.1e-56	217.6
Cma07g00128	CST	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.0	1.1e-56	217.6
Cma02g00036	CST	53	257	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	1.5e-56	217.2
Cma20g00260	CST	51	255	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	1.5e-56	217.2
Cma01g00265	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	53.6	1.9e-56	216.9
Cma11g01288	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.2	4.0e-54	209.1
Cma19g00866	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.6	2.6e-53	206.5
Cma04g00918	.	46	252	Chloroplast and Mitochondria Gene Families	AT4G10340	54.0	4.9e-52	202.2
Cma16g00808	.	46	252	Chloroplast and Mitochondria Gene Families	AT4G10340	54.0	4.9e-52	202.2
Cma03g01380	CST	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	87.6	8.2e-134	473.8
Cma02g00036	CST	3	269	Chloroplast and Mitochondria Gene Families	AT2G34420	88.1	1.1e-133	473.4
Cma03g01381	CST	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	87.6	1.4e-133	473.0
Cma20g00260	CST	1	267	Chloroplast and Mitochondria Gene Families	AT2G34420	87.3	1.4e-133	473.0
Cma13g00541	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	86.9	5.3e-133	471.1
Cma07g00129	CST	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	87.3	7.0e-133	470.7
Cma07g00128	CST	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	87.3	7.0e-133	470.7
Cma01g00265	.	4	265	Chloroplast and Mitochondria Gene Families	AT2G34420	86.0	1.5e-127	453.0
Cma14g00956	.	16	278	Chloroplast and Mitochondria Gene Families	AT2G34420	83.5	1.4e-125	446.4
Cma19g00866	.	3	265	Chloroplast and Mitochondria Gene Families	AT2G34420	76.4	7.7e-116	414.1
Cma11g01288	.	3	265	Chloroplast and Mitochondria Gene Families	AT2G34420	76.4	1.1e-114	410.2
Cma04g00918	.	46	264	Chloroplast and Mitochondria Gene Families	AT2G34420	75.0	2.4e-93	339.3
Cma16g00808	.	46	264	Chloroplast and Mitochondria Gene Families	AT2G34420	75.0	2.4e-93	339.3
Cma03g01380	CST	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	87.6	6.8e-136	480.7
Cma03g01381	CST	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	87.6	1.2e-135	479.9
Cma13g00541	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	87.2	1.5e-135	479.6
Cma07g00129	CST	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	87.6	1.3e-134	476.5
Cma07g00128	CST	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	87.6	1.3e-134	476.5
Cma20g00260	CST	1	267	Chloroplast and Mitochondria Gene Families	AT2G34430	86.9	6.3e-134	474.2
Cma02g00036	CST	3	269	Chloroplast and Mitochondria Gene Families	AT2G34430	88.1	1.8e-133	472.6
Cma01g00265	.	4	265	Chloroplast and Mitochondria Gene Families	AT2G34430	86.0	2.1e-129	459.1
Cma14g00956	.	16	278	Chloroplast and Mitochondria Gene Families	AT2G34430	83.8	2.0e-127	452.6
Cma19g00866	.	30	265	Chloroplast and Mitochondria Gene Families	AT2G34430	82.8	1.1e-114	410.2
Cma11g01288	.	30	265	Chloroplast and Mitochondria Gene Families	AT2G34430	82.8	1.2e-113	406.8
Cma04g00918	.	46	264	Chloroplast and Mitochondria Gene Families	AT2G34430	75.0	3.2e-93	339.0
Cma16g00808	.	46	264	Chloroplast and Mitochondria Gene Families	AT2G34430	75.0	3.2e-93	339.0
Cma03g00360	.	56	338	Chloroplast and Mitochondria Gene Families	AT5G01530	83.5	5.1e-137	484.6
Cma07g01046	CCT,CST	712	985	Chloroplast and Mitochondria Gene Families	AT5G01530	77.6	3.4e-125	445.3
Cma16g00739	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	93.8	5.0e-144	507.7
Cma04g00859	.	764	1017	Chloroplast and Mitochondria Gene Families	AT5G40810	93.7	2.6e-140	495.4
Cma16g00739	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	85.2	2.1e-149	525.8
Cma04g00859	.	717	1017	Chloroplast and Mitochondria Gene Families	AT3G27240	84.5	4.1e-145	511.5
Cma02g00724	CST	5	327	Chloroplast and Mitochondria Gene Families	AT2G30160	74.1	3.9e-141	498.4
Cma20g00327	CST	5	319	Chloroplast and Mitochondria Gene Families	AT2G30160	71.6	6.0e-134	474.6
Cma03g00330	CST	3	303	Chloroplast and Mitochondria Gene Families	AT2G30160	65.7	1.1e-111	400.6
Cma07g01076	CST	9	310	Chloroplast and Mitochondria Gene Families	AT2G30160	64.8	5.1e-109	391.7
Cma02g00724	CST	5	329	Chloroplast and Mitochondria Gene Families	AT1G07030	74.4	1.5e-140	496.5
Cma20g00327	CST	1	319	Chloroplast and Mitochondria Gene Families	AT1G07030	72.3	3.8e-133	471.9
Cma03g00330	CST	3	303	Chloroplast and Mitochondria Gene Families	AT1G07030	68.6	6.6e-117	417.9
Cma07g01076	CST	5	310	Chloroplast and Mitochondria Gene Families	AT1G07030	65.9	1.3e-112	403.7
Cma08g00444	.	86	390	Chloroplast and Mitochondria Gene Families	AT2G47490	75.1	1.4e-132	469.9
Cma15g00924	.	28	321	Chloroplast and Mitochondria Gene Families	AT2G47490	61.7	3.2e-105	379.0
Cma17g01062	.	1	277	Chloroplast and Mitochondria Gene Families	AT2G47490	59.8	1.2e-88	323.9
Cma15g00924	.	20	372	Chloroplast and Mitochondria Gene Families	AT1G25380	61.6	2.3e-118	422.9
Cma08g00444	.	96	381	Chloroplast and Mitochondria Gene Families	AT1G25380	64.4	8.4e-105	377.9
Cma13g00678	.	622	1205	Chloroplast and Mitochondria Gene Families	AT4G21490	74.0	1.5e-257	885.9
Cma19g00965	CCT	1	574	Chloroplast and Mitochondria Gene Families	AT4G21490	64.2	4.6e-222	768.1
Cma02g00129	.	5	353	Chloroplast and Mitochondria Gene Families	AT4G21490	64.5	5.6e-127	452.2
Cma02g00130	CCT	1	201	Chloroplast and Mitochondria Gene Families	AT4G21490	71.3	2.5e-82	303.9
Cma08g00784	.	4	186	Chloroplast and Mitochondria Gene Families	AT1G17530	65.6	2.6e-62	235.7
Cma17g00711	.	15	186	Chloroplast and Mitochondria Gene Families	AT1G17530	68.2	1.7e-61	233.0
Cma10g01008	.	5	180	Chloroplast and Mitochondria Gene Families	AT1G17530	57.3	2.3e-50	196.1
Cma11g00986	.	13	179	Chloroplast and Mitochondria Gene Families	AT1G17530	60.4	6.7e-50	194.5
Cma10g01008	.	15	184	Chloroplast and Mitochondria Gene Families	AT3G04800	59.1	1.1e-50	197.2
Cma11g00986	.	12	183	Chloroplast and Mitochondria Gene Families	AT3G04800	57.2	1.8e-50	196.4
Cma17g00711	.	22	190	Chloroplast and Mitochondria Gene Families	AT3G04800	55.0	1.2e-43	173.7
Cma08g00784	.	22	190	Chloroplast and Mitochondria Gene Families	AT3G04800	55.0	1.6e-43	173.3
Cma17g00711	.	15	190	Chloroplast and Mitochondria Gene Families	AT1G72750	69.6	2.9e-64	242.3
Cma08g00784	.	15	190	Chloroplast and Mitochondria Gene Families	AT1G72750	69.1	1.1e-63	240.4
Cma10g01008	.	12	184	Chloroplast and Mitochondria Gene Families	AT1G72750	59.7	1.9e-52	203.0
Cma11g00986	.	13	183	Chloroplast and Mitochondria Gene Families	AT1G72750	59.2	1.6e-51	199.9
Cma18g01050	CCT,ECH	605	818	Chloroplast and Mitochondria Gene Families	AT1G26100	62.1	4.8e-69	258.5
Cma04g02842	CST	34	259	Chloroplast and Mitochondria Gene Families	AT5G38630	70.5	8.3e-90	327.4
Cma15g00193	CST	1	226	Chloroplast and Mitochondria Gene Families	AT5G38630	68.7	5.9e-88	321.2
Cma19g00416	.	23	218	Chloroplast and Mitochondria Gene Families	AT4G25570	75.0	4.4e-85	312.0
Cma04g02217	.	9	364	Chloroplast and Mitochondria Gene Families	AT5G14040	81.3	2.9e-169	592.0
Cma15g00816	.	9	356	Chloroplast and Mitochondria Gene Families	AT5G14040	81.4	1.2e-167	586.6
Cma11g01543	.	9	363	Chloroplast and Mitochondria Gene Families	AT5G14040	77.7	4.5e-162	568.2
Cma10g00026	CST	39	347	Chloroplast and Mitochondria Gene Families	AT5G14040	84.3	1.2e-154	543.5
Cma11g01327	.	11	298	Chloroplast and Mitochondria Gene Families	AT5G14040	52.7	2.0e-85	313.5
Cma11g01543	.	11	363	Chloroplast and Mitochondria Gene Families	AT3G48850	73.1	2.0e-146	516.2
Cma15g00816	.	8	356	Chloroplast and Mitochondria Gene Families	AT3G48850	71.5	4.9e-145	511.5
Cma04g02217	.	8	363	Chloroplast and Mitochondria Gene Families	AT3G48850	70.2	5.4e-144	508.1
Cma10g00026	CST	12	347	Chloroplast and Mitochondria Gene Families	AT3G48850	69.3	3.3e-141	498.8
Cma11g01327	.	11	297	Chloroplast and Mitochondria Gene Families	AT3G48850	51.5	7.4e-85	311.6
Cma11g01327	.	8	305	Chloroplast and Mitochondria Gene Families	AT2G17270	72.6	2.5e-126	449.1
Cma11g01543	.	67	358	Chloroplast and Mitochondria Gene Families	AT2G17270	52.7	3.3e-86	315.8
Cma15g00816	.	62	352	Chloroplast and Mitochondria Gene Families	AT2G17270	52.6	2.8e-85	312.8
Cma04g02217	.	62	363	Chloroplast and Mitochondria Gene Families	AT2G17270	50.7	1.1e-84	310.8
Cma10g00026	CST	51	341	Chloroplast and Mitochondria Gene Families	AT2G17270	50.5	5.3e-84	308.5
Cma15g00225	CST	16	319	Chloroplast and Mitochondria Gene Families	AT5G15640	75.9	2.3e-130	462.6
Cma04g02808	CST	16	319	Chloroplast and Mitochondria Gene Families	AT5G15640	75.9	2.3e-130	462.6
Cma15g00239	.	2	169	Chloroplast and Mitochondria Gene Families	AT5G15640	71.9	1.6e-67	253.8
Cma01g01712	CCT	1	341	Chloroplast and Mitochondria Gene Families	AT5G26200	66.6	5.3e-125	444.9
Cma09g00357	CCT	12	344	Chloroplast and Mitochondria Gene Families	AT5G26200	66.7	2.6e-124	442.6
Cma17g00701	.	1	342	Chloroplast and Mitochondria Gene Families	AT5G26200	58.4	3.6e-105	379.0
Cma08g00787	.	1	336	Chloroplast and Mitochondria Gene Families	AT5G26200	56.7	2.0e-100	363.2
Cma17g00701	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	76.8	4.1e-149	525.0
Cma08g00787	.	1	340	Chloroplast and Mitochondria Gene Families	AT1G72820	73.9	1.5e-143	506.5
Cma01g01712	CCT	1	342	Chloroplast and Mitochondria Gene Families	AT1G72820	69.6	1.6e-129	459.9
Cma09g00357	CCT	1	345	Chloroplast and Mitochondria Gene Families	AT1G72820	69.1	1.4e-128	456.8
Cma18g01268	CST	778	981	Chloroplast and Mitochondria Gene Families	AT5G52570	57.8	6.1e-56	214.9
Cma15g01247	.	75	280	Chloroplast and Mitochondria Gene Families	AT5G52570	51.9	5.9e-51	198.4
Cma16g00100	CST	495	713	Chloroplast and Mitochondria Gene Families	AT4G25700	62.8	3.5e-69	258.8
Cma18g01268	CST	682	900	Chloroplast and Mitochondria Gene Families	AT4G25700	63.1	1.5e-67	253.4
Cma15g01247	.	62	197	Chloroplast and Mitochondria Gene Families	AT4G25700	73.5	2.6e-56	216.1
Cma16g00806	.	72	359	Chloroplast and Mitochondria Gene Families	AT5G54290	79.3	4.8e-121	431.8
Cma11g00420	.	43	546	Chloroplast and Mitochondria Gene Families	AT2G18710	84.5	4.2e-241	831.2

Syn-Orthogroups

Select	Orthogroup	Bda	Bhi	Blo	Bma	Bpe	Cam	Car	Cco	Cec	Chy	Cla	Clacu	Cma	Cme	Cmetu	Cmo	Cmu	Cone	Cpe	Cre	Csa	HCH	Hepe	Lac	Lcy	Lsi	Mch	Sed	Tan	Vvi	Total
	OG0000927	2	2	2	2	3	3	4	3	3	2	3	3	4	3	3	4	3	3	4	3	3	2	2	3	3	2	3	3	3	2	85

Transcriptome

Select	Gene	Chr	Type	da1	da2	da3	da4	da5	da6	da7	da8	da9	da10
	Cma11g01543	Cma_Chr11	FPKM	1.318145	2.070167	5.139612	6.04856	2.414986	2.549512	1.875695	13.882154	12.411735	13.617563