Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cma13g00676 ATGAACGACTTATTCTCGAATTCGTTCAAACAGTACACGGATCTGAAGCAACAGGCGTCTGTGGACGGCATGGAGTCTGGGAATGAGACTGTGAATTTGGACACGTTCTTCGAGGATGTCGAGAATGTTAAAGACGACATGAAACAGGTCGAGAATTTGTACAAGAAATTGCAACAGGACAATGAGGAATGCAAGATTGTCCACAATGCCAAGACGATGAAGGAGCTGAGGGGCAGAATGGAGGCCGATGTCGCCCAGGTTCTGAAGCGAGTCAAAATGATTAAAGGCAAACTCGAGGCTCTGGATCGTTCCAACGCCGCTCACCGCAGCCTCCCCGGTTGCGGCCCTGGCTCCTCCGCCGACCGAACCCGAACCTCCGTCGTCAGCGGCTTGGGGAAGAAGCTCAAAGATGTCATGGATGAGTTTCAAGGCCTCAGAGGTCGAATGAACGCCGAATACAAAGAAACCATCGAGCGCAGGTACTTCACAGTGACAGGGCAGAAAGCCGACGAAGAGACAATAGAGAATTTGATAGCAAGTGGGGAAAGCGAGAGCTTCCTCCAGAAGGCGATTCAAGAACAGGGGAGGGGTCAGATAATGGACACAATCTCAGAGATTCAGGAGCGACACGACGCTGTGAAGGAGATAGAGAAGAATTTGTTAGAGCTGCATCAAATTTTCTTGGACATGGCGGCGCTAGTGGAGGCACAAGGGCACCAGCTGAACGACATCGAGAGCCATGTCGCGCATGCGAACTCGTTCGTGAGAAGAGGAACAGAGCAGCTTCAGGAAGCCAGAGAGATACAGAAGAGCTCGAGGAAATGGACTTGCTATGCCATTATCTTGGGGGTTGTTCTTATTATCATCATCCTCTTCCCGATCTTGACTACAATTTTACCTCATTTGTTGTAG 912 50.11 MNDLFSNSFKQYTDLKQQASVDGMESGNETVNLDTFFEDVENVKDDMKQVENLYKKLQQDNEECKIVHNAKTMKELRGRMEADVAQVLKRVKMIKGKLEALDRSNAAHRSLPGCGPGSSADRTRTSVVSGLGKKLKDVMDEFQGLRGRMNAEYKETIERRYFTVTGQKADEETIENLIASGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQIFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTEQLQEAREIQKSSRKWTCYAIILGVVLIIIILFPILTTILPHLL 303
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
13 6245413 6246796 - CmaCh13G006760.1 Cma13g00676 306503

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cma13g00676 303 PANTHER SYNTAXIN-124-RELATED 6 294 - -
Cma13g00676 303 Gene3D - 193 298 - -
Cma13g00676 303 CDD SNARE_syntaxin1-like 202 264 - -
Cma13g00676 303 Pfam Syntaxin 36 238 IPR006011 GO:0016020
Cma13g00676 303 SMART SynN_4 28 154 IPR006011 GO:0016020
Cma13g00676 303 ProSitePatterns Syntaxin / epimorphin family signature. 209 248 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cma13g00676 303 CDD SynN 33 190 IPR006011 GO:0016020
Cma13g00676 303 Gene3D - 33 160 - -
Cma13g00676 303 PANTHER SYNTAXIN 6 294 IPR045242 -
Cma13g00676 303 SMART tSNARE_6 198 265 IPR000727 -
Cma13g00676 303 Coils Coil 33 67 - -
Cma13g00676 303 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 203 265 IPR000727 -
Cma13g00676 303 Pfam SNARE domain 240 291 IPR000727 -
Cma13g00676 303 SUPERFAMILY t-snare proteins 32 258 IPR010989 GO:0016020|GO:0016192
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cma13g00676 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101217140 516.924
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cma03g00248 Cma-Chr3:3546408 Cma13g00676 Cma-Chr13:6245413 1.23E-89 dispersed
Cma03g00740 Cma-Chr3:5887631 Cma13g00676 Cma-Chr13:6245413 9.55E-62 dispersed
Cma07g01172 Cma-Chr7:6428287 Cma13g00676 Cma-Chr13:6245413 4.18E-91 dispersed
Cma13g00676 Cma-Chr13:6245413 Cma14g00365 Cma-Chr14:1632018 3.27E-107 dispersed
Cma13g00676 Cma-Chr13:6245413 Cma18g00344 Cma-Chr18:1843481 0 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cma05g00643 . 22 353 SNARE and Associated Proteins AT3G24350 65.1 2.7e-103 372.9
Cma12g00301 . 443 750 SNARE and Associated Proteins AT3G24350 62.3 3.1e-91 332.8
Cma07g01172 . 1 308 SNARE and Associated Proteins AT1G08560 67.5 1.5e-99 360.1
Cma03g00248 . 1 312 SNARE and Associated Proteins AT1G08560 67.7 3.0e-95 345.9
Cma03g00740 . 1 303 SNARE and Associated Proteins AT2G18260 53.4 2.6e-83 306.2
Cma14g00365 . 1330 1590 SNARE and Associated Proteins AT3G11820 80.8 4.6e-115 411.8
Cma06g00530 . 19 264 SNARE and Associated Proteins AT3G11820 72.4 1.9e-100 363.2
Cma07g00822 . 21 278 SNARE and Associated Proteins AT3G11820 69.4 1.7e-98 356.7
Cma18g00344 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.6e-94 342.8
Cma13g00676 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 2.1e-91 333.2
Cma14g01106 . 67 325 SNARE and Associated Proteins AT3G11820 52.1 6.5e-69 258.5
Cma14g00365 . 1312 1590 SNARE and Associated Proteins AT3G52400 63.9 2.0e-92 336.7
Cma07g00822 . 1 277 SNARE and Associated Proteins AT3G52400 59.4 2.6e-84 309.7
Cma13g00676 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.7e-81 299.7
Cma06g00530 . 14 264 SNARE and Associated Proteins AT3G52400 60.7 8.8e-80 294.7
Cma18g00344 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.5e-79 293.9
Cma14g01106 . 77 325 SNARE and Associated Proteins AT3G52400 50.2 4.5e-60 229.2
Cma18g00344 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 9.9e-107 384.0
Cma13g00676 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.3e-106 383.6
Cma14g00365 . 1312 1591 SNARE and Associated Proteins AT4G03330 57.7 9.9e-83 304.3
Cma07g00822 . 1 278 SNARE and Associated Proteins AT4G03330 52.7 2.0e-75 280.0
Cma06g00530 . 1 269 SNARE and Associated Proteins AT4G03330 54.1 1.3e-74 277.3
Cma14g01106 . 77 325 SNARE and Associated Proteins AT4G03330 55.4 1.8e-68 256.9
Cma18g00344 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 2.6e-128 455.7
Cma13g00676 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 7.2e-126 447.6
Cma14g00365 . 1312 1591 SNARE and Associated Proteins AT1G61290 61.0 7.1e-89 324.7
Cma06g00530 . 1 279 SNARE and Associated Proteins AT1G61290 56.4 1.5e-83 307.0
Cma07g00822 . 1 296 SNARE and Associated Proteins AT1G61290 54.4 6.4e-82 301.6
Cma14g01106 . 75 325 SNARE and Associated Proteins AT1G61290 51.0 4.6e-64 242.3
Cma18g00344 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 3.2e-126 448.7
Cma13g00676 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 4.3e-123 438.3
Cma14g00365 . 1312 1591 SNARE and Associated Proteins AT1G11250 61.8 3.9e-92 335.5
Cma06g00530 . 1 279 SNARE and Associated Proteins AT1G11250 57.5 3.2e-86 315.8
Cma07g00822 . 1 291 SNARE and Associated Proteins AT1G11250 55.0 3.3e-83 305.8
Cma14g01106 . 60 325 SNARE and Associated Proteins AT1G11250 51.1 8.8e-68 254.6
Cma14g01106 . 48 344 SNARE and Associated Proteins AT3G03800 74.4 1.9e-113 406.4
Cma20g00629 . 1 270 SNARE and Associated Proteins AT3G03800 57.3 4.5e-75 278.9
Cma14g01106 . 48 243 SNARE and Associated Proteins AT5G08080 77.6 7.0e-78 287.7
Cma20g00629 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 1.6e-53 206.8
Cma06g00638 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cma16g01176 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cma06g00638 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.8e-81 299.3
Cma16g01176 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.8e-80 296.6
Cma06g00638 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 3.2e-74 275.8
Cma16g01176 CST 1 256 SNARE and Associated Proteins AT4G17730 61.7 9.5e-74 274.2
Cma16g01176 CST 65 256 SNARE and Associated Proteins AT1G32270 60.9 7.0e-53 205.3
Cma06g00638 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.3e-51 201.1
Cma04g01124 CST 1 334 SNARE and Associated Proteins AT5G05760 66.0 8.6e-112 401.0
Cma04g00161 CST 1 334 SNARE and Associated Proteins AT5G05760 60.9 1.6e-102 370.2
Cma05g00643 . 22 353 SNARE and Associated Proteins AT3G24350 65.1 2.7e-103 372.9
Cma12g00301 . 443 750 SNARE and Associated Proteins AT3G24350 62.3 3.1e-91 332.8
Cma12g01045 CST 1 327 SNARE and Associated Proteins AT5G26980 74.9 6.5e-125 444.5
Cma05g01087 CST 1 318 SNARE and Associated Proteins AT5G26980 75.5 2.3e-122 436.0
Cma17g01060 . 1 320 SNARE and Associated Proteins AT5G26980 65.2 8.5e-101 364.4
Cma12g01045 CST 1 329 SNARE and Associated Proteins AT4G02195 63.1 1.6e-102 370.2
Cma05g01087 CST 1 318 SNARE and Associated Proteins AT4G02195 63.0 3.5e-102 369.0
Cma17g01060 . 1 320 SNARE and Associated Proteins AT4G02195 64.4 2.9e-101 365.9
Cma12g01045 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.2e-126 450.3
Cma05g01087 CST 1 318 SNARE and Associated Proteins AT3G05710 74.6 1.5e-124 443.4
Cma17g01060 . 1 320 SNARE and Associated Proteins AT3G05710 63.4 2.4e-98 356.3
Cma01g01111 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.4e-91 332.0
Cma09g00975 CCT,CST 66 294 SNARE and Associated Proteins AT1G16240 70.4 6.2e-85 311.2
Cma16g00924 CCT 3 188 SNARE and Associated Proteins AT1G16240 53.7 6.0e-56 214.9
Cma01g01111 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.9e-90 329.7
Cma09g00975 CCT,CST 51 294 SNARE and Associated Proteins AT1G79590 68.7 5.4e-85 311.6
Cma16g00924 CCT 2 188 SNARE and Associated Proteins AT1G79590 53.7 1.4e-56 217.2
Cma01g00944 . 5 199 SNARE and Associated Proteins AT1G28490 69.7 1.9e-66 249.6
Cma17g00042 . 162 352 SNARE and Associated Proteins AT1G28490 70.2 1.8e-64 243.0
Cma14g00203 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 2.4e-109 392.5
Cma01g01054 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 9.2e-109 390.6
Cma02g00885 . 1 264 SNARE and Associated Proteins AT3G09740 67.5 4.9e-94 341.7
Cma01g01054 . 1 261 SNARE and Associated Proteins AT3G45280 64.0 2.2e-86 316.2
Cma02g00885 . 1 264 SNARE and Associated Proteins AT3G45280 63.8 3.8e-86 315.5
Cma14g00203 . 1 261 SNARE and Associated Proteins AT3G45280 63.6 1.4e-85 313.5
Cma01g01054 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 2.0e-95 346.3
Cma14g00203 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 4.3e-95 345.1
Cma02g00885 . 1 261 SNARE and Associated Proteins AT3G61450 60.5 2.2e-83 306.2
Cma04g02924 CST 65 309 SNARE and Associated Proteins AT1G51740 73.6 6.5e-93 337.8
Cma15g00119 CST 302 531 SNARE and Associated Proteins AT1G51740 72.7 4.5e-86 315.1
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0005716 1 1 1 2 2 1 2 1 1 1 1 1 2 1 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 1 37
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cma13g00676 Cma_Chr13 FPKM 0.591743 0.688401 0.350797 0.400184 1.134966 1.036855 0.529033 0.600528 0.323865 0.457413