Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cma14g01106 ATGAAGGGTTTCGGCAACAACGTTGTGTTCGATAGAGGAGGTGGCAGCGATGCGACTCAAGGTTTCGGAAGTGATGTGCTCGACAGAGACTTGGTGCAGAAATCTTTCAAAGGAACGGAGGAAAGTCTCGGGGACAATGATTCCTTTGAGATCCCTCGGGGTCAGCCTTCTAGAGGAGGAGACATTGAGCTTGGAACAAATGCTCCTACAAGTGCAGGAGATCTGGGCTTGGATGATTTCTTTAAAAAGGTCCAAGATATTGAAAAACAGAATGAGAAGCTGGACAGGTTATTGCGAAAGCTCCAGGATTCACACGAGGAGTCCAAAGCTGTGACTAAAGCTCCAGCAATGAAAGCAATCAAGCAGCGAATGGAAAAGGATGTTGATGAAGTTGGAAAAGTTGCACGTTTTGTGAAGAGCAAGGTCGAAGAACTTGACAAGGAGAATCTGGCAAATAGGCAGAAGCCTGGATGTGGTAAAGGATCAGGTGTAGATAGATCAAGAACAGCAACTACTCTTGCCTTAAAAAAGAAGTTGAAAGACAAGATGACTGAGTTCCAGATTTTGCGGGAAAAAGTTCATCAAGAGTATCGGGAGGTTGTTGAGAGACGGGTTTTCACAGTCACGGGCGCTAGGGCTGACGAAGAGACCATCGAGAAATTAATCGAAACTGGGGATAGCGAACAAATTTTTCAGAAGGCAATCCAAGAACAAGGGCGAGGACAGGTAATGGACACTCTAGCTGAAATTCAAGAGCGTCACAGCGCAGTTAGAGAACTGGAGAGGAAGTTACTCGAGCTACAGCAGGTATTTCTGGACATGGCTGTTTTGGTAGATGCACAGGGGGATATGCTCGACAATATCGAATCACATGTTACAAGTGCAGTAGATCATGTGCAACAAGGGAACACTGCACTTCAAAAGGCAAAGAAGCTTCAAAAGAATTCAAGGAAATGGATGTGCATTGCCATAATAATCCTTCTAATCATTGTTGTGGTGGTAGTAGTGGGAGTCCTAAAGCCATGGAATAGTGTACTTTAA 1041 44.76 MKGFGNNVVFDRGGGSDATQGFGSDVLDRDLVQKSFKGTEESLGDNDSFEIPRGQPSRGGDIELGTNAPTSAGDLGLDDFFKKVQDIEKQNEKLDRLLRKLQDSHEESKAVTKAPAMKAIKQRMEKDVDEVGKVARFVKSKVEELDKENLANRQKPGCGKGSGVDRSRTATTLALKKKLKDKMTEFQILREKVHQEYREVVERRVFTVTGARADEETIEKLIETGDSEQIFQKAIQEQGRGQVMDTLAEIQERHSAVRELERKLLELQQVFLDMAVLVDAQGDMLDNIESHVTSAVDHVQQGNTALQKAKKLQKNSRKWMCIAIIILLIIVVVVVVGVLKPWNSVL 346
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
14 8118923 8128792 + CmaCh14G011060.1 Cma14g01106 308089

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cma14g01106 346 Coils Coil 250 270 - -
Cma14g01106 346 SMART tSNARE_6 242 309 IPR000727 -
Cma14g01106 346 Pfam Syntaxin 79 282 IPR006011 GO:0016020
Cma14g01106 346 PANTHER - 47 339 - -
Cma14g01106 346 PANTHER SYNTAXIN 47 339 IPR045242 -
Cma14g01106 346 CDD SNARE_syntaxin1-like 246 308 - -
Cma14g01106 346 Pfam SNARE domain 283 335 IPR000727 -
Cma14g01106 346 ProSitePatterns Syntaxin / epimorphin family signature. 253 292 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cma14g01106 346 Gene3D - 74 201 - -
Cma14g01106 346 MobiDBLite consensus disorder prediction 1 24 - -
Cma14g01106 346 CDD SynN 77 234 IPR006011 GO:0016020
Cma14g01106 346 SMART SynN_4 72 198 IPR006011 GO:0016020
Cma14g01106 346 Coils Coil 77 111 - -
Cma14g01106 346 Gene3D - 238 340 - -
Cma14g01106 346 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 247 309 IPR000727 -
Cma14g01106 346 SUPERFAMILY t-snare proteins 75 302 IPR010989 GO:0016020|GO:0016192
Cma14g01106 346 MobiDBLite consensus disorder prediction 37 70 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cma14g01106 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101203075 493.812
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cma02g00159 Cma-Chr2:738486 Cma14g01106 Cma-Chr14:8118923 4.97E-13 dispersed
Cma14g01106 Cma-Chr14:8118923 Cma18g00344 Cma-Chr18:1843481 4.79E-90 dispersed
Cma14g01106 Cma-Chr14:8118923 Cma20g00629 Cma-Chr20:2935522 9.64E-107 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cma05g00643 . 22 353 SNARE and Associated Proteins AT3G24350 65.1 2.7e-103 372.9
Cma12g00301 . 443 750 SNARE and Associated Proteins AT3G24350 62.3 3.1e-91 332.8
Cma07g01172 . 1 308 SNARE and Associated Proteins AT1G08560 67.5 1.5e-99 360.1
Cma03g00248 . 1 312 SNARE and Associated Proteins AT1G08560 67.7 3.0e-95 345.9
Cma03g00740 . 1 303 SNARE and Associated Proteins AT2G18260 53.4 2.6e-83 306.2
Cma14g00365 . 1330 1590 SNARE and Associated Proteins AT3G11820 80.8 4.6e-115 411.8
Cma06g00530 . 19 264 SNARE and Associated Proteins AT3G11820 72.4 1.9e-100 363.2
Cma07g00822 . 21 278 SNARE and Associated Proteins AT3G11820 69.4 1.7e-98 356.7
Cma18g00344 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.6e-94 342.8
Cma13g00676 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 2.1e-91 333.2
Cma14g01106 . 67 325 SNARE and Associated Proteins AT3G11820 52.1 6.5e-69 258.5
Cma14g00365 . 1312 1590 SNARE and Associated Proteins AT3G52400 63.9 2.0e-92 336.7
Cma07g00822 . 1 277 SNARE and Associated Proteins AT3G52400 59.4 2.6e-84 309.7
Cma13g00676 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.7e-81 299.7
Cma06g00530 . 14 264 SNARE and Associated Proteins AT3G52400 60.7 8.8e-80 294.7
Cma18g00344 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.5e-79 293.9
Cma14g01106 . 77 325 SNARE and Associated Proteins AT3G52400 50.2 4.5e-60 229.2
Cma18g00344 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 9.9e-107 384.0
Cma13g00676 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.3e-106 383.6
Cma14g00365 . 1312 1591 SNARE and Associated Proteins AT4G03330 57.7 9.9e-83 304.3
Cma07g00822 . 1 278 SNARE and Associated Proteins AT4G03330 52.7 2.0e-75 280.0
Cma06g00530 . 1 269 SNARE and Associated Proteins AT4G03330 54.1 1.3e-74 277.3
Cma14g01106 . 77 325 SNARE and Associated Proteins AT4G03330 55.4 1.8e-68 256.9
Cma18g00344 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 2.6e-128 455.7
Cma13g00676 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 7.2e-126 447.6
Cma14g00365 . 1312 1591 SNARE and Associated Proteins AT1G61290 61.0 7.1e-89 324.7
Cma06g00530 . 1 279 SNARE and Associated Proteins AT1G61290 56.4 1.5e-83 307.0
Cma07g00822 . 1 296 SNARE and Associated Proteins AT1G61290 54.4 6.4e-82 301.6
Cma14g01106 . 75 325 SNARE and Associated Proteins AT1G61290 51.0 4.6e-64 242.3
Cma18g00344 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 3.2e-126 448.7
Cma13g00676 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 4.3e-123 438.3
Cma14g00365 . 1312 1591 SNARE and Associated Proteins AT1G11250 61.8 3.9e-92 335.5
Cma06g00530 . 1 279 SNARE and Associated Proteins AT1G11250 57.5 3.2e-86 315.8
Cma07g00822 . 1 291 SNARE and Associated Proteins AT1G11250 55.0 3.3e-83 305.8
Cma14g01106 . 60 325 SNARE and Associated Proteins AT1G11250 51.1 8.8e-68 254.6
Cma14g01106 . 48 344 SNARE and Associated Proteins AT3G03800 74.4 1.9e-113 406.4
Cma20g00629 . 1 270 SNARE and Associated Proteins AT3G03800 57.3 4.5e-75 278.9
Cma14g01106 . 48 243 SNARE and Associated Proteins AT5G08080 77.6 7.0e-78 287.7
Cma20g00629 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 1.6e-53 206.8
Cma06g00638 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cma16g01176 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cma06g00638 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.8e-81 299.3
Cma16g01176 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.8e-80 296.6
Cma06g00638 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 3.2e-74 275.8
Cma16g01176 CST 1 256 SNARE and Associated Proteins AT4G17730 61.7 9.5e-74 274.2
Cma16g01176 CST 65 256 SNARE and Associated Proteins AT1G32270 60.9 7.0e-53 205.3
Cma06g00638 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.3e-51 201.1
Cma04g01124 CST 1 334 SNARE and Associated Proteins AT5G05760 66.0 8.6e-112 401.0
Cma04g00161 CST 1 334 SNARE and Associated Proteins AT5G05760 60.9 1.6e-102 370.2
Cma05g00643 . 22 353 SNARE and Associated Proteins AT3G24350 65.1 2.7e-103 372.9
Cma12g00301 . 443 750 SNARE and Associated Proteins AT3G24350 62.3 3.1e-91 332.8
Cma12g01045 CST 1 327 SNARE and Associated Proteins AT5G26980 74.9 6.5e-125 444.5
Cma05g01087 CST 1 318 SNARE and Associated Proteins AT5G26980 75.5 2.3e-122 436.0
Cma17g01060 . 1 320 SNARE and Associated Proteins AT5G26980 65.2 8.5e-101 364.4
Cma12g01045 CST 1 329 SNARE and Associated Proteins AT4G02195 63.1 1.6e-102 370.2
Cma05g01087 CST 1 318 SNARE and Associated Proteins AT4G02195 63.0 3.5e-102 369.0
Cma17g01060 . 1 320 SNARE and Associated Proteins AT4G02195 64.4 2.9e-101 365.9
Cma12g01045 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.2e-126 450.3
Cma05g01087 CST 1 318 SNARE and Associated Proteins AT3G05710 74.6 1.5e-124 443.4
Cma17g01060 . 1 320 SNARE and Associated Proteins AT3G05710 63.4 2.4e-98 356.3
Cma01g01111 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.4e-91 332.0
Cma09g00975 CCT,CST 66 294 SNARE and Associated Proteins AT1G16240 70.4 6.2e-85 311.2
Cma16g00924 CCT 3 188 SNARE and Associated Proteins AT1G16240 53.7 6.0e-56 214.9
Cma01g01111 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.9e-90 329.7
Cma09g00975 CCT,CST 51 294 SNARE and Associated Proteins AT1G79590 68.7 5.4e-85 311.6
Cma16g00924 CCT 2 188 SNARE and Associated Proteins AT1G79590 53.7 1.4e-56 217.2
Cma01g00944 . 5 199 SNARE and Associated Proteins AT1G28490 69.7 1.9e-66 249.6
Cma17g00042 . 162 352 SNARE and Associated Proteins AT1G28490 70.2 1.8e-64 243.0
Cma14g00203 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 2.4e-109 392.5
Cma01g01054 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 9.2e-109 390.6
Cma02g00885 . 1 264 SNARE and Associated Proteins AT3G09740 67.5 4.9e-94 341.7
Cma01g01054 . 1 261 SNARE and Associated Proteins AT3G45280 64.0 2.2e-86 316.2
Cma02g00885 . 1 264 SNARE and Associated Proteins AT3G45280 63.8 3.8e-86 315.5
Cma14g00203 . 1 261 SNARE and Associated Proteins AT3G45280 63.6 1.4e-85 313.5
Cma01g01054 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 2.0e-95 346.3
Cma14g00203 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 4.3e-95 345.1
Cma02g00885 . 1 261 SNARE and Associated Proteins AT3G61450 60.5 2.2e-83 306.2
Cma04g02924 CST 65 309 SNARE and Associated Proteins AT1G51740 73.6 6.5e-93 337.8
Cma15g00119 CST 302 531 SNARE and Associated Proteins AT1G51740 72.7 4.5e-86 315.1
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001189 1 6 1 1 1 2 3 2 2 2 2 2 3 2 3 3 2 4 3 2 3 1 2 3 3 2 3 8 3 2 77
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cma14g01106 Cma_Chr14 FPKM 33.554756 34.721001 20.762558 22.171099 21.069715 21.960665 26.127831 24.479126 25.33383 23.379566