Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cma15g00603 ATGGCTGCAACCTCTGGTGCTGTGCTTAATGGGTTGGGCTCACCCTTCCTCCGTGGAGGTAGCAGAACCCAGACCTTGTTGGCTGGAGCCAGAGGCGGTGTCAATGTCGTTGGCTCTCGCAAGCTTGTCATCGTCGCCGCTGCTCAGCCCAAGAAGTCTTGGATCCCTGCTGTTAAGGGCGGAGGCAACTTAGTCGACCCAGAATGGCTAGATGGCTCACTTCCAGGTGACTTCGGCTTCGACCCATTAGGGTTGGGGAAGGACCCTGCATTTCTGAAATGGTACAGAGAGGCAGAGCTGATCCACGGCCGGTGGGCAATGGCAGCGGTGGTCGGAATCTTCGTAGGGCAAGCCTGGAGTGGGATCCCATGGTTCGAAGCCGGAGCCGATCCAGGCGCAATTGCTCCATTCTCCTTCGGATCACTGCTGGGAACCCAGCTTCTACTAATGGGATGGGTGGAGAGCAAGCGGTGGGTGGATTTCTTCAACCCAGAGTCTCAATCGGTGGAATGGGCGACGCCATGGTCGAGGACAGCAGAGAACTTCGCAAACGCAACAGGAGAACAGGGTTATCCCGGCGGAAAATTCTTCGATCCGTTGGGATTTGCCGGAACTATTAAAGATGGGGTTTACATTCCAGACACGGAGAAATTGGAGAGATTGAAGTTGGCTGAGATCAAGCATGCTAGGATCGCCATGTTAGCGATGCTCATCTTCTACTTTGAAGCTGGACAGGGTAAGACGCCATTGGGGGCTCTTGGAGTATAA 768 54.69 MAATSGAVLNGLGSPFLRGGSRTQTLLAGARGGVNVVGSRKLVIVAAAQPKKSWIPAVKGGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLGFAGTIKDGVYIPDTEKLERLKLAEIKHARIAMLAMLIFYFEAGQGKTPLGALGV 255
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
15 2856967 2858175 - CmaCh15G006030.1 Cma15g00603 309753

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cma15g00603 255 Pfam Chlorophyll A-B binding protein 67 243 IPR022796 -
Cma15g00603 255 Gene3D Chlorophyll a/b binding protein domain 67 254 - -
Cma15g00603 255 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 2 255 IPR001344 GO:0009765|GO:0016020
Cma15g00603 255 SUPERFAMILY Chlorophyll a-b binding protein 59 254 - -
Cma15g00603 255 PANTHER CHLOROPHYLL A-B BINDING PROTEIN, CHLOROPLASTIC 2 255 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cma15g00603 K08917 LHCB6; light-harvesting complex II chlorophyll a/b binding protein 6 - csv:101204705 503.442
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cma11g01642 Cma-Chr11:10800460 Cma15g00603 Cma-Chr15:2856967 7.69E-180 dispersed
Cma15g00603 Cma-Chr15:2856967 Cma11g00746 Cma-Chr11:3627834 2.17E-37 dispersed
Cma15g00603 Cma-Chr15:2856967 Cma04g01836 Cma-Chr4:9264652 9.83E-35 transposed
Cma15g00603 Cma-Chr15:2856967 Cma18g00694 Cma-Chr18:6352027 1.32E-34 transposed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cma01g00591 . 1 407 Chloroplast and Mitochondria Gene Families AT2G28800 65.1 4.0e-138 488.8
Cma05g00057 . 71 410 Chloroplast and Mitochondria Gene Families AT2G28800 57.1 1.3e-99 360.9
Cma12g00046 . 71 423 Chloroplast and Mitochondria Gene Families AT2G28800 52.9 7.2e-95 345.1
Cma15g00603 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.7 1.3e-120 429.9
Cma11g01642 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.0 3.0e-120 428.7
Cma19g00866 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 8.3e-143 503.8
Cma11g01288 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 8.3e-143 503.8
Cma01g00265 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 4.5e-120 428.3
Cma03g01380 CST 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.9e-119 425.6
Cma03g01381 CST 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.9e-119 425.6
Cma13g00541 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 3.8e-119 425.2
Cma07g00129 CST 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 4.9e-119 424.9
Cma07g00128 CST 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 4.9e-119 424.9
Cma02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT3G27690 76.2 6.4e-119 424.5
Cma20g00260 CST 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 76.3 1.9e-118 422.9
Cma14g00956 . 8 278 Chloroplast and Mitochondria Gene Families AT3G27690 75.2 4.2e-118 421.8
Cma16g00808 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 66.8 1.8e-97 353.2
Cma04g00918 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 65.7 5.9e-96 348.2
Cma09g00012 . 113 329 Chloroplast and Mitochondria Gene Families AT3G27690 52.1 1.2e-53 207.6
Cma01g00890 . 73 276 Chloroplast and Mitochondria Gene Families AT3G27690 53.1 5.2e-52 202.2
Cma04g01836 . 3 262 Chloroplast and Mitochondria Gene Families AT3G61470 81.7 4.0e-125 444.9
Cma18g00694 . 3 262 Chloroplast and Mitochondria Gene Families AT3G61470 83.2 5.2e-125 444.5
Cma11g00746 . 60 262 Chloroplast and Mitochondria Gene Families AT3G61470 65.5 4.4e-84 308.5
Cma11g00139 . 22 250 Chloroplast and Mitochondria Gene Families AT3G61470 50.6 1.3e-62 237.3
Cma01g00793 . 270 493 Chloroplast and Mitochondria Gene Families AT3G61470 50.2 1.1e-61 234.2
Cma15g00450 CST 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 5.0e-89 324.7
Cma04g02584 CST 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 79.9 9.4e-88 320.5
Cma03g00360 . 54 338 Chloroplast and Mitochondria Gene Families AT3G08940 83.6 1.2e-135 479.9
Cma07g01046 CCT,CST 712 985 Chloroplast and Mitochondria Gene Families AT3G08940 78.2 6.4e-124 441.0
Cma09g00012 . 3 336 Chloroplast and Mitochondria Gene Families AT1G76570 71.0 6.1e-139 491.1
Cma11g01288 . 47 256 Chloroplast and Mitochondria Gene Families AT1G76570 50.5 5.2e-53 205.7
Cma19g00866 . 47 256 Chloroplast and Mitochondria Gene Families AT1G76570 50.5 6.7e-53 205.3
Cma11g00901 CCT 439 712 Chloroplast and Mitochondria Gene Families AT1G61520 86.9 8.2e-137 483.8
Cma10g00869 . 1 257 Chloroplast and Mitochondria Gene Families AT1G61520 84.8 3.2e-125 445.3
Cma19g00866 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.1 5.7e-143 504.2
Cma11g01288 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 88.7 1.7e-142 502.7
Cma03g01380 CST 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 8.8e-120 427.2
Cma03g01381 CST 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 8.8e-120 427.2
Cma13g00541 . 7 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.8 2.0e-119 426.0
Cma20g00260 CST 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 4.4e-119 424.9
Cma07g00129 CST 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 5.7e-119 424.5
Cma07g00128 CST 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 5.7e-119 424.5
Cma01g00265 . 8 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.8 2.2e-118 422.5
Cma02g00036 CST 8 269 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 2.8e-118 422.2
Cma14g00956 . 14 278 Chloroplast and Mitochondria Gene Families AT2G05070 77.2 1.6e-116 416.4
Cma16g00808 . 7 264 Chloroplast and Mitochondria Gene Families AT2G05070 67.8 2.8e-97 352.4
Cma04g00918 . 8 264 Chloroplast and Mitochondria Gene Families AT2G05070 66.9 6.8e-96 347.8
Cma09g00012 . 113 329 Chloroplast and Mitochondria Gene Families AT2G05070 51.6 3.5e-52 202.6
Cma01g00890 . 73 276 Chloroplast and Mitochondria Gene Families AT2G05070 53.6 3.5e-52 202.6
Cma11g01288 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.0 8.3e-125 444.1
Cma19g00866 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.9e-124 443.0
Cma03g01380 CST 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 2.2e-101 366.3
Cma03g01381 CST 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 2.9e-101 365.9
Cma13g00541 . 7 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.1 6.4e-101 364.8
Cma07g00129 CST 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 1.4e-100 363.6
Cma07g00128 CST 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 1.4e-100 363.6
Cma01g00265 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 1.9e-100 363.2
Cma20g00260 CST 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 3.2e-100 362.5
Cma02g00036 CST 8 241 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 9.3e-100 360.9
Cma14g00956 . 14 250 Chloroplast and Mitochondria Gene Families AT2G05100 75.8 1.3e-98 357.1
Cma16g00808 . 7 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.4 2.3e-82 303.1
Cma04g00918 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 66.4 7.4e-81 298.1
Cma09g00012 . 113 313 Chloroplast and Mitochondria Gene Families AT2G05100 50.2 2.1e-43 173.7
Cma01g00890 . 73 260 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 3.6e-43 172.9
Cma03g00360 . 53 221 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 2.5e-68 255.8
Cma07g01046 CCT,CST 715 877 Chloroplast and Mitochondria Gene Families AT2G40100 71.3 2.2e-64 242.7
Cma13g00541 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.0 8.9e-136 480.3
Cma20g00260 CST 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 87.7 9.8e-135 476.9
Cma03g01380 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 1.3e-134 476.5
Cma02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 1.7e-134 476.1
Cma03g01381 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 2.2e-134 475.7
Cma07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 1.1e-133 473.4
Cma07g00128 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 1.1e-133 473.4
Cma01g00265 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 85.3 9.8e-127 450.3
Cma14g00956 . 16 278 Chloroplast and Mitochondria Gene Families AT1G29930 83.1 7.0e-125 444.1
Cma19g00866 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 77.5 1.7e-115 412.9
Cma11g01288 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 77.9 1.9e-114 409.5
Cma04g00918 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29930 74.5 1.9e-93 339.7
Cma16g00808 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29930 74.5 1.9e-93 339.7
Cma01g00890 . 57 276 Chloroplast and Mitochondria Gene Families AT1G29930 50.9 2.1e-52 203.4
Cma13g00541 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 3.4e-135 478.4
Cma20g00260 CST 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 3.7e-134 474.9
Cma03g01380 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 4.9e-134 474.6
Cma02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 6.3e-134 474.2
Cma03g01381 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 8.3e-134 473.8
Cma07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 4.1e-133 471.5
Cma07g00128 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 4.1e-133 471.5
Cma01g00265 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 85.3 1.3e-126 449.9
Cma14g00956 . 16 278 Chloroplast and Mitochondria Gene Families AT1G29920 83.1 9.2e-125 443.7
Cma19g00866 . 31 265 Chloroplast and Mitochondria Gene Families AT1G29920 82.8 2.3e-115 412.5
Cma11g01288 . 31 265 Chloroplast and Mitochondria Gene Families AT1G29920 83.3 2.5e-114 409.1
Cma04g00918 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29920 74.5 1.9e-93 339.7
Cma16g00808 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29920 74.5 1.9e-93 339.7
Cma01g00890 . 57 276 Chloroplast and Mitochondria Gene Families AT1G29920 50.9 2.1e-52 203.4
Cma13g00541 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 3.4e-135 478.4
Cma20g00260 CST 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 3.7e-134 474.9
Cma03g01380 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 4.9e-134 474.6
Cma02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 6.3e-134 474.2
Cma03g01381 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 8.3e-134 473.8
Cma07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 4.1e-133 471.5
Cma07g00128 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 4.1e-133 471.5
Cma01g00265 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 85.3 1.3e-126 449.9
Cma14g00956 . 16 278 Chloroplast and Mitochondria Gene Families AT1G29910 83.1 9.2e-125 443.7
Cma19g00866 . 31 265 Chloroplast and Mitochondria Gene Families AT1G29910 82.8 2.3e-115 412.5
Cma11g01288 . 31 265 Chloroplast and Mitochondria Gene Families AT1G29910 83.3 2.5e-114 409.1
Cma04g00918 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29910 74.5 1.9e-93 339.7
Cma16g00808 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29910 74.5 1.9e-93 339.7
Cma01g00890 . 57 276 Chloroplast and Mitochondria Gene Families AT1G29910 50.9 2.1e-52 203.4
Cma01g00890 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 82.9 8.7e-134 473.8
Cma13g00541 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 8.6e-57 218.0
Cma03g01380 CST 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 8.6e-57 218.0
Cma03g01381 CST 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 8.6e-57 218.0
Cma14g00956 . 62 266 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.6
Cma07g00129 CST 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 1.1e-56 217.6
Cma07g00128 CST 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 1.1e-56 217.6
Cma02g00036 CST 53 257 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.5e-56 217.2
Cma20g00260 CST 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.5e-56 217.2
Cma01g00265 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 1.9e-56 216.9
Cma11g01288 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 4.0e-54 209.1
Cma19g00866 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.6e-53 206.5
Cma04g00918 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 4.9e-52 202.2
Cma16g00808 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 4.9e-52 202.2
Cma03g01380 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 8.2e-134 473.8
Cma02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT2G34420 88.1 1.1e-133 473.4
Cma03g01381 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 1.4e-133 473.0
Cma20g00260 CST 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 1.4e-133 473.0
Cma13g00541 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 5.3e-133 471.1
Cma07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 7.0e-133 470.7
Cma07g00128 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 7.0e-133 470.7
Cma01g00265 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.0 1.5e-127 453.0
Cma14g00956 . 16 278 Chloroplast and Mitochondria Gene Families AT2G34420 83.5 1.4e-125 446.4
Cma19g00866 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 76.4 7.7e-116 414.1
Cma11g01288 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 76.4 1.1e-114 410.2
Cma04g00918 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34420 75.0 2.4e-93 339.3
Cma16g00808 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34420 75.0 2.4e-93 339.3
Cma03g01380 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 6.8e-136 480.7
Cma03g01381 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.2e-135 479.9
Cma13g00541 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 1.5e-135 479.6
Cma07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.3e-134 476.5
Cma07g00128 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.3e-134 476.5
Cma20g00260 CST 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 86.9 6.3e-134 474.2
Cma02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 1.8e-133 472.6
Cma01g00265 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.0 2.1e-129 459.1
Cma14g00956 . 16 278 Chloroplast and Mitochondria Gene Families AT2G34430 83.8 2.0e-127 452.6
Cma19g00866 . 30 265 Chloroplast and Mitochondria Gene Families AT2G34430 82.8 1.1e-114 410.2
Cma11g01288 . 30 265 Chloroplast and Mitochondria Gene Families AT2G34430 82.8 1.2e-113 406.8
Cma04g00918 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34430 75.0 3.2e-93 339.0
Cma16g00808 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34430 75.0 3.2e-93 339.0
Cma03g00360 . 56 338 Chloroplast and Mitochondria Gene Families AT5G01530 83.5 5.1e-137 484.6
Cma07g01046 CCT,CST 712 985 Chloroplast and Mitochondria Gene Families AT5G01530 77.6 3.4e-125 445.3
Cma16g00739 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 5.0e-144 507.7
Cma04g00859 . 764 1017 Chloroplast and Mitochondria Gene Families AT5G40810 93.7 2.6e-140 495.4
Cma16g00739 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.2 2.1e-149 525.8
Cma04g00859 . 717 1017 Chloroplast and Mitochondria Gene Families AT3G27240 84.5 4.1e-145 511.5
Cma02g00724 CST 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 74.1 3.9e-141 498.4
Cma20g00327 CST 5 319 Chloroplast and Mitochondria Gene Families AT2G30160 71.6 6.0e-134 474.6
Cma03g00330 CST 3 303 Chloroplast and Mitochondria Gene Families AT2G30160 65.7 1.1e-111 400.6
Cma07g01076 CST 9 310 Chloroplast and Mitochondria Gene Families AT2G30160 64.8 5.1e-109 391.7
Cma02g00724 CST 5 329 Chloroplast and Mitochondria Gene Families AT1G07030 74.4 1.5e-140 496.5
Cma20g00327 CST 1 319 Chloroplast and Mitochondria Gene Families AT1G07030 72.3 3.8e-133 471.9
Cma03g00330 CST 3 303 Chloroplast and Mitochondria Gene Families AT1G07030 68.6 6.6e-117 417.9
Cma07g01076 CST 5 310 Chloroplast and Mitochondria Gene Families AT1G07030 65.9 1.3e-112 403.7
Cma08g00444 . 86 390 Chloroplast and Mitochondria Gene Families AT2G47490 75.1 1.4e-132 469.9
Cma15g00924 . 28 321 Chloroplast and Mitochondria Gene Families AT2G47490 61.7 3.2e-105 379.0
Cma17g01062 . 1 277 Chloroplast and Mitochondria Gene Families AT2G47490 59.8 1.2e-88 323.9
Cma15g00924 . 20 372 Chloroplast and Mitochondria Gene Families AT1G25380 61.6 2.3e-118 422.9
Cma08g00444 . 96 381 Chloroplast and Mitochondria Gene Families AT1G25380 64.4 8.4e-105 377.9
Cma13g00678 . 622 1205 Chloroplast and Mitochondria Gene Families AT4G21490 74.0 1.5e-257 885.9
Cma19g00965 CCT 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.2 4.6e-222 768.1
Cma02g00129 . 5 353 Chloroplast and Mitochondria Gene Families AT4G21490 64.5 5.6e-127 452.2
Cma02g00130 CCT 1 201 Chloroplast and Mitochondria Gene Families AT4G21490 71.3 2.5e-82 303.9
Cma08g00784 . 4 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.6 2.6e-62 235.7
Cma17g00711 . 15 186 Chloroplast and Mitochondria Gene Families AT1G17530 68.2 1.7e-61 233.0
Cma10g01008 . 5 180 Chloroplast and Mitochondria Gene Families AT1G17530 57.3 2.3e-50 196.1
Cma11g00986 . 13 179 Chloroplast and Mitochondria Gene Families AT1G17530 60.4 6.7e-50 194.5
Cma10g01008 . 15 184 Chloroplast and Mitochondria Gene Families AT3G04800 59.1 1.1e-50 197.2
Cma11g00986 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 57.2 1.8e-50 196.4
Cma17g00711 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 1.2e-43 173.7
Cma08g00784 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 1.6e-43 173.3
Cma17g00711 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.6 2.9e-64 242.3
Cma08g00784 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.1 1.1e-63 240.4
Cma10g01008 . 12 184 Chloroplast and Mitochondria Gene Families AT1G72750 59.7 1.9e-52 203.0
Cma11g00986 . 13 183 Chloroplast and Mitochondria Gene Families AT1G72750 59.2 1.6e-51 199.9
Cma18g01050 CCT,ECH 605 818 Chloroplast and Mitochondria Gene Families AT1G26100 62.1 4.8e-69 258.5
Cma04g02842 CST 34 259 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 8.3e-90 327.4
Cma15g00193 CST 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 68.7 5.9e-88 321.2
Cma19g00416 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 75.0 4.4e-85 312.0
Cma04g02217 . 9 364 Chloroplast and Mitochondria Gene Families AT5G14040 81.3 2.9e-169 592.0
Cma15g00816 . 9 356 Chloroplast and Mitochondria Gene Families AT5G14040 81.4 1.2e-167 586.6
Cma11g01543 . 9 363 Chloroplast and Mitochondria Gene Families AT5G14040 77.7 4.5e-162 568.2
Cma10g00026 CST 39 347 Chloroplast and Mitochondria Gene Families AT5G14040 84.3 1.2e-154 543.5
Cma11g01327 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.7 2.0e-85 313.5
Cma11g01543 . 11 363 Chloroplast and Mitochondria Gene Families AT3G48850 73.1 2.0e-146 516.2
Cma15g00816 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 71.5 4.9e-145 511.5
Cma04g02217 . 8 363 Chloroplast and Mitochondria Gene Families AT3G48850 70.2 5.4e-144 508.1
Cma10g00026 CST 12 347 Chloroplast and Mitochondria Gene Families AT3G48850 69.3 3.3e-141 498.8
Cma11g01327 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 51.5 7.4e-85 311.6
Cma11g01327 . 8 305 Chloroplast and Mitochondria Gene Families AT2G17270 72.6 2.5e-126 449.1
Cma11g01543 . 67 358 Chloroplast and Mitochondria Gene Families AT2G17270 52.7 3.3e-86 315.8
Cma15g00816 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.6 2.8e-85 312.8
Cma04g02217 . 62 363 Chloroplast and Mitochondria Gene Families AT2G17270 50.7 1.1e-84 310.8
Cma10g00026 CST 51 341 Chloroplast and Mitochondria Gene Families AT2G17270 50.5 5.3e-84 308.5
Cma15g00225 CST 16 319 Chloroplast and Mitochondria Gene Families AT5G15640 75.9 2.3e-130 462.6
Cma04g02808 CST 16 319 Chloroplast and Mitochondria Gene Families AT5G15640 75.9 2.3e-130 462.6
Cma15g00239 . 2 169 Chloroplast and Mitochondria Gene Families AT5G15640 71.9 1.6e-67 253.8
Cma01g01712 CCT 1 341 Chloroplast and Mitochondria Gene Families AT5G26200 66.6 5.3e-125 444.9
Cma09g00357 CCT 12 344 Chloroplast and Mitochondria Gene Families AT5G26200 66.7 2.6e-124 442.6
Cma17g00701 . 1 342 Chloroplast and Mitochondria Gene Families AT5G26200 58.4 3.6e-105 379.0
Cma08g00787 . 1 336 Chloroplast and Mitochondria Gene Families AT5G26200 56.7 2.0e-100 363.2
Cma17g00701 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 76.8 4.1e-149 525.0
Cma08g00787 . 1 340 Chloroplast and Mitochondria Gene Families AT1G72820 73.9 1.5e-143 506.5
Cma01g01712 CCT 1 342 Chloroplast and Mitochondria Gene Families AT1G72820 69.6 1.6e-129 459.9
Cma09g00357 CCT 1 345 Chloroplast and Mitochondria Gene Families AT1G72820 69.1 1.4e-128 456.8
Cma18g01268 CST 778 981 Chloroplast and Mitochondria Gene Families AT5G52570 57.8 6.1e-56 214.9
Cma15g01247 . 75 280 Chloroplast and Mitochondria Gene Families AT5G52570 51.9 5.9e-51 198.4
Cma16g00100 CST 495 713 Chloroplast and Mitochondria Gene Families AT4G25700 62.8 3.5e-69 258.8
Cma18g01268 CST 682 900 Chloroplast and Mitochondria Gene Families AT4G25700 63.1 1.5e-67 253.4
Cma15g01247 . 62 197 Chloroplast and Mitochondria Gene Families AT4G25700 73.5 2.6e-56 216.1
Cma16g00806 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.3 4.8e-121 431.8
Cma11g00420 . 43 546 Chloroplast and Mitochondria Gene Families AT2G18710 84.5 4.2e-241 831.2
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0004103 4 1 2 3 2 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 2 1 1 1 2 1 0 2 1 1 44
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cma15g00603 Cma_Chr15 FPKM 0.179249 0.290846 12.779723 11.04974 351.693115 348.502167 334.646332 4.005733 3.113149 3.521501