Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cma17g00042 ATGGATTACCCTCTCCTTGGATTCGTGCTCGTTATCGTCGTCGTATGTTGTCATTCCGTCGAACTCGTCCTTCTTGGGGCTGTTGCTGTCGTTGCCGCCATGTTCAGAGAAGTAAAAGCTCAGTTCCCGCCCGCTTCACTGAGCTTTGAAACAAATAATGAAATTGGAAAAGTATTTAGATTTGGAGAGAAACGAGGAGGAGAGTTTCTCTCTCTTCGAATCCTCTCCACAGGTCGTTGCGCTCTCCCTTCACCAGCAAGCATTCAGCAATTTCTTCATCAGATCTACACTCTCCACCGCCCTCATTCTCAGTTGAACATGCCATCGGCTCAAGATCCGTTCTATGTTGTAAAAGACGAGATTCAAGAATCTATCGATAAAGTGCAATCCAGCTTTCACCAATGGGAAAGGATATCTTCTGATCCAGGAGAGAGAGCACAACAAACAAAAGAGTTGCTCGCTTCCTGTGAGAGTATTGAATGGCAGGTGGACGAATTGGACAAAGCTATTGCTGTGGCAGCTAGAGATCCTTCTTGGTATGGCATTGATCATGCGGAACTTGAGAAACGAAGGAGGTGGACGAGTACAGCTAGGATGCAGGTTGGAAATGTTAAGAAAGTAGTAGGAGCTGGAAAGGAGCAAACTGGAACTGCTAGTGCAAGTGGGATGCGTCGAGAATTGATGAGACTACCCAATGCACTTGAAACAGAAGAATCAAACTTATATTCAGCCCACCAAGAAAATGATGACTTCATCTCATCCGAATCAGATAGACAGCTGCTTCTAATAAGGCAGCAGGACGAGGAGTTGGATGAATTGAGTGCGAGTGTGGTGAGAATTGGAGGTGTTGGGCTCACAATACATGAAGAGCTCCTTGCACAGGATAAAATTATTGACAACCTAGGGATGGAAATGGACAGTACATCGAATCGTCTTGATTTTGTTCAGAAAAAAGTAGCTGTGGTGATGAAGAAGGCCAGCGCCAAGGGGCAGATAATGATGATATTATTCTTGGTAGCTTTGTTCATCATCCTTTTTGTGTTGGTGTTCCTCACCTAG 1059 44.95 MDYPLLGFVLVIVVVCCHSVELVLLGAVAVVAAMFREVKAQFPPASLSFETNNEIGKVFRFGEKRGGEFLSLRILSTGRCALPSPASIQQFLHQIYTLHRPHSQLNMPSAQDPFYVVKDEIQESIDKVQSSFHQWERISSDPGERAQQTKELLASCESIEWQVDELDKAIAVAARDPSWYGIDHAELEKRRRWTSTARMQVGNVKKVVGAGKEQTGTASASGMRRELMRLPNALETEESNLYSAHQENDDFISSESDRQLLLIRQQDEELDELSASVVRIGGVGLTIHEELLAQDKIIDNLGMEMDSTSNRLDFVQKKVAVVMKKASAKGQIMMILFLVALFIILFVLVFLT 352
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
17 187111 191264 - CmaCh17G000420.1 Cma17g00042 311937

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cma17g00042 352 CDD SNARE_Qc 263 320 - -
Cma17g00042 352 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 260 322 IPR000727 -
Cma17g00042 352 PANTHER SYNTAXIN PROTEIN 107 351 - -
Cma17g00042 352 Pfam Syntaxin 6, N-terminal 112 205 IPR015260 GO:0016020|GO:0048193
Cma17g00042 352 SUPERFAMILY SNARE fusion complex 259 322 - -
Cma17g00042 352 Gene3D - 108 210 - -
Cma17g00042 352 SUPERFAMILY t-snare proteins 111 206 IPR010989 GO:0016020|GO:0016192
Cma17g00042 352 Gene3D - 267 331 - -
Cma17g00042 352 ProSitePatterns Syntaxin / epimorphin family signature. 266 305 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cma17g00042 352 Pfam SNARE domain 297 348 IPR000727 -
Cma17g00042 352 PANTHER SYNTAXIN 107 351 IPR045242 -
Cma17g00042 352 SMART tSNARE_6 255 322 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cma17g00042 K08500 SYP6; syntaxin of plants SYP6 - csv:101212527 400.979
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cma01g00944 Cma-Chr1:5997055 Cma17g00042 Cma-Chr17:187111 4.50E-121 dispersed
Cma01g00945 Cma-Chr1:6005532 Cma17g00042 Cma-Chr17:187111 8.45E-08 dispersed
Cma01g01111 Cma-Chr1:8131197 Cma17g00042 Cma-Chr17:187111 3.16E-09 dispersed
Cma16g00924 Cma-Chr16:7034135 Cma17g00042 Cma-Chr17:187111 2.42E-07 dispersed
Cma17g00042 Cma-Chr17:187111 Cma09g00975 Cma-Chr9:4947413 7.37E-09 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cma05g00643 . 22 353 SNARE and Associated Proteins AT3G24350 65.1 2.7e-103 372.9
Cma12g00301 . 443 750 SNARE and Associated Proteins AT3G24350 62.3 3.1e-91 332.8
Cma07g01172 . 1 308 SNARE and Associated Proteins AT1G08560 67.5 1.5e-99 360.1
Cma03g00248 . 1 312 SNARE and Associated Proteins AT1G08560 67.7 3.0e-95 345.9
Cma03g00740 . 1 303 SNARE and Associated Proteins AT2G18260 53.4 2.6e-83 306.2
Cma14g00365 . 1330 1590 SNARE and Associated Proteins AT3G11820 80.8 4.6e-115 411.8
Cma06g00530 . 19 264 SNARE and Associated Proteins AT3G11820 72.4 1.9e-100 363.2
Cma07g00822 . 21 278 SNARE and Associated Proteins AT3G11820 69.4 1.7e-98 356.7
Cma18g00344 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.6e-94 342.8
Cma13g00676 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 2.1e-91 333.2
Cma14g01106 . 67 325 SNARE and Associated Proteins AT3G11820 52.1 6.5e-69 258.5
Cma14g00365 . 1312 1590 SNARE and Associated Proteins AT3G52400 63.9 2.0e-92 336.7
Cma07g00822 . 1 277 SNARE and Associated Proteins AT3G52400 59.4 2.6e-84 309.7
Cma13g00676 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.7e-81 299.7
Cma06g00530 . 14 264 SNARE and Associated Proteins AT3G52400 60.7 8.8e-80 294.7
Cma18g00344 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.5e-79 293.9
Cma14g01106 . 77 325 SNARE and Associated Proteins AT3G52400 50.2 4.5e-60 229.2
Cma18g00344 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 9.9e-107 384.0
Cma13g00676 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.3e-106 383.6
Cma14g00365 . 1312 1591 SNARE and Associated Proteins AT4G03330 57.7 9.9e-83 304.3
Cma07g00822 . 1 278 SNARE and Associated Proteins AT4G03330 52.7 2.0e-75 280.0
Cma06g00530 . 1 269 SNARE and Associated Proteins AT4G03330 54.1 1.3e-74 277.3
Cma14g01106 . 77 325 SNARE and Associated Proteins AT4G03330 55.4 1.8e-68 256.9
Cma18g00344 . 1 303 SNARE and Associated Proteins AT1G61290 78.9 2.6e-128 455.7
Cma13g00676 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 7.2e-126 447.6
Cma14g00365 . 1312 1591 SNARE and Associated Proteins AT1G61290 61.0 7.1e-89 324.7
Cma06g00530 . 1 279 SNARE and Associated Proteins AT1G61290 56.4 1.5e-83 307.0
Cma07g00822 . 1 296 SNARE and Associated Proteins AT1G61290 54.4 6.4e-82 301.6
Cma14g01106 . 75 325 SNARE and Associated Proteins AT1G61290 51.0 4.6e-64 242.3
Cma18g00344 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 3.2e-126 448.7
Cma13g00676 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 4.3e-123 438.3
Cma14g00365 . 1312 1591 SNARE and Associated Proteins AT1G11250 61.8 3.9e-92 335.5
Cma06g00530 . 1 279 SNARE and Associated Proteins AT1G11250 57.5 3.2e-86 315.8
Cma07g00822 . 1 291 SNARE and Associated Proteins AT1G11250 55.0 3.3e-83 305.8
Cma14g01106 . 60 325 SNARE and Associated Proteins AT1G11250 51.1 8.8e-68 254.6
Cma14g01106 . 48 344 SNARE and Associated Proteins AT3G03800 74.4 1.9e-113 406.4
Cma20g00629 . 1 270 SNARE and Associated Proteins AT3G03800 57.3 4.5e-75 278.9
Cma14g01106 . 48 243 SNARE and Associated Proteins AT5G08080 77.6 7.0e-78 287.7
Cma20g00629 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 1.6e-53 206.8
Cma06g00638 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cma16g01176 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cma06g00638 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.8e-81 299.3
Cma16g01176 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.8e-80 296.6
Cma06g00638 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 3.2e-74 275.8
Cma16g01176 CST 1 256 SNARE and Associated Proteins AT4G17730 61.7 9.5e-74 274.2
Cma16g01176 CST 65 256 SNARE and Associated Proteins AT1G32270 60.9 7.0e-53 205.3
Cma06g00638 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.3e-51 201.1
Cma04g01124 CST 1 334 SNARE and Associated Proteins AT5G05760 66.0 8.6e-112 401.0
Cma04g00161 CST 1 334 SNARE and Associated Proteins AT5G05760 60.9 1.6e-102 370.2
Cma05g00643 . 22 353 SNARE and Associated Proteins AT3G24350 65.1 2.7e-103 372.9
Cma12g00301 . 443 750 SNARE and Associated Proteins AT3G24350 62.3 3.1e-91 332.8
Cma12g01045 CST 1 327 SNARE and Associated Proteins AT5G26980 74.9 6.5e-125 444.5
Cma05g01087 CST 1 318 SNARE and Associated Proteins AT5G26980 75.5 2.3e-122 436.0
Cma17g01060 . 1 320 SNARE and Associated Proteins AT5G26980 65.2 8.5e-101 364.4
Cma12g01045 CST 1 329 SNARE and Associated Proteins AT4G02195 63.1 1.6e-102 370.2
Cma05g01087 CST 1 318 SNARE and Associated Proteins AT4G02195 63.0 3.5e-102 369.0
Cma17g01060 . 1 320 SNARE and Associated Proteins AT4G02195 64.4 2.9e-101 365.9
Cma12g01045 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.2e-126 450.3
Cma05g01087 CST 1 318 SNARE and Associated Proteins AT3G05710 74.6 1.5e-124 443.4
Cma17g01060 . 1 320 SNARE and Associated Proteins AT3G05710 63.4 2.4e-98 356.3
Cma01g01111 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.4e-91 332.0
Cma09g00975 CCT,CST 66 294 SNARE and Associated Proteins AT1G16240 70.4 6.2e-85 311.2
Cma16g00924 CCT 3 188 SNARE and Associated Proteins AT1G16240 53.7 6.0e-56 214.9
Cma01g01111 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.9e-90 329.7
Cma09g00975 CCT,CST 51 294 SNARE and Associated Proteins AT1G79590 68.7 5.4e-85 311.6
Cma16g00924 CCT 2 188 SNARE and Associated Proteins AT1G79590 53.7 1.4e-56 217.2
Cma01g00944 . 5 199 SNARE and Associated Proteins AT1G28490 69.7 1.9e-66 249.6
Cma17g00042 . 162 352 SNARE and Associated Proteins AT1G28490 70.2 1.8e-64 243.0
Cma14g00203 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 2.4e-109 392.5
Cma01g01054 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 9.2e-109 390.6
Cma02g00885 . 1 264 SNARE and Associated Proteins AT3G09740 67.5 4.9e-94 341.7
Cma01g01054 . 1 261 SNARE and Associated Proteins AT3G45280 64.0 2.2e-86 316.2
Cma02g00885 . 1 264 SNARE and Associated Proteins AT3G45280 63.8 3.8e-86 315.5
Cma14g00203 . 1 261 SNARE and Associated Proteins AT3G45280 63.6 1.4e-85 313.5
Cma01g01054 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 2.0e-95 346.3
Cma14g00203 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 4.3e-95 345.1
Cma02g00885 . 1 261 SNARE and Associated Proteins AT3G61450 60.5 2.2e-83 306.2
Cma04g02924 CST 65 309 SNARE and Associated Proteins AT1G51740 73.6 6.5e-93 337.8
Cma15g00119 CST 302 531 SNARE and Associated Proteins AT1G51740 72.7 4.5e-86 315.1
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003549 2 1 2 2 2 1 2 1 1 1 1 1 2 1 1 2 1 2 1 1 1 1 1 1 1 1 1 5 4 0 44
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cma17g00042 Cma_Chr17 FPKM 10.394581 8.525618 7.59021 7.529566 10.364353 12.394655 10.273407 9.847227 10.902868 10.150233