Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cme03g00333 ATGGCTGCAACTTCTGGTGCTGTGCTTAATGGATTGGGCTCACCCTTCCTCCGTGGAAGTAGCAGAACTCGGACCTTGCTGGCCGGAGCTAGAGGTGGTGTCAATGTTGTCAGTTCTAGCAAGCTTGTCGTCATCGCTGCTGCTCAGCCTAAGAAGTCTTGGATCCCTGGTGTTAGGGGTGGTGGCAACTTGGTCGACCCAGAATGGCTTGATGGCTCACTTCCAGGTGACTACGGCTTCGACCCATTGGGTTTGGGGAAGGACCCAGCATTTTTGAAGTGGTATAGAGAAGCAGAGCTGATCCACGGGCGGTGGGCAATGGCAGCAGTGGTCGGAATCTTCGTCGGACAAGCCTGGAGTGGAATCCCATGGTTCGAAGCCGGAGCAGATCCAGGCGCAATTGCTCCATTCTCCTTCGGATCACTTCTAGGAACCCAGCTTCTGCTGATGGGATGGGTTGAAAGCAAACGATGGGTGGATTTCTTCAACCCAGAATCTCAATCGGTGGAATGGGCAACGCCATGGTCGAGGACGGCAGAGAATTTCGCAAACGCTACCGGAGAACAAGGGTATCCCGGAGGAAAATTCTTCGATCCATTGGGATTTGCAGGAACTCTTAAAGATGGGGTTTACATTCCAGACACGGAGAAATTGGAGAGATTGAAGTTGGCAGAAATCAAGCATGCTAGGATCGCCATGTTAGCAATGCTCATCTTCTACTTTGAAGCTGGACAAGGGAAGACACCATTGGGTGCTCTTGGATTGTAA 768 51.69 MAATSGAVLNGLGSPFLRGSSRTRTLLAGARGGVNVVSSSKLVVIAAAQPKKSWIPGVRGGGNLVDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLGFAGTLKDGVYIPDTEKLERLKLAEIKHARIAMLAMLIFYFEAGQGKTPLGALGL 255
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
3 4366294 4368292 - MELO3C008358.2.1 Cme03g00333 322344

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cme03g00333 255 SUPERFAMILY Chlorophyll a-b binding protein 64 255 - -
Cme03g00333 255 Pfam Chlorophyll A-B binding protein 67 243 IPR022796 -
Cme03g00333 255 Gene3D Chlorophyll a/b binding protein domain 67 254 - -
Cme03g00333 255 PANTHER CHLOROPHYLL A-B BINDING PROTEIN, CHLOROPLASTIC 2 255 - -
Cme03g00333 255 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 2 255 IPR001344 GO:0009765|GO:0016020
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cme03g00333 K08917 LHCB6; light-harvesting complex II chlorophyll a/b binding protein 6 - csv:101204705 516.153
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cme03g00333 Cme-Chr3:4366294 Cme03g02045 Cme-Chr3:27959543 1.76E-32 dispersed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cme12g00204 . 54 432 Chloroplast and Mitochondria Gene Families AT2G28800 62.0 1.3e-122 436.8
Cme03g02205 . 71 425 Chloroplast and Mitochondria Gene Families AT2G28800 55.2 1.3e-98 357.1
Cme03g00333 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 80.8 2.6e-118 421.8
Cme01g00539 . 1 272 Chloroplast and Mitochondria Gene Families AT3G27690 87.2 6.6e-142 500.4
Cme11g01575 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 6.4e-121 430.6
Cme08g00161 . 75 338 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 1.1e-120 429.9
Cme08g00160 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 3.2e-120 428.3
Cme12g01212 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 1.0e-118 423.3
Cme04g01040 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.9 1.5e-117 419.5
Cme06g02076 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 66.3 4.9e-97 351.3
Cme09g00132 . 71 274 Chloroplast and Mitochondria Gene Families AT3G27690 52.6 1.1e-51 200.7
Cme10g00664 . 1 156 Chloroplast and Mitochondria Gene Families AT3G61470 92.9 4.7e-88 321.2
Cme02g00318 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 3.1e-87 318.5
Cme05g01586 . 1 197 Chloroplast and Mitochondria Gene Families AT3G54890 82.0 9.3e-90 326.6
Cme08g02519 . 3 284 Chloroplast and Mitochondria Gene Families AT3G08940 83.4 1.2e-135 479.6
Cme07g00015 . 55 253 Chloroplast and Mitochondria Gene Families AT1G76570 75.4 3.8e-90 328.6
Cme02g00798 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 85.3 8.4e-136 479.9
Cme01g00539 . 1 272 Chloroplast and Mitochondria Gene Families AT2G05070 87.1 1.0e-141 499.6
Cme08g00161 . 78 338 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 2.8e-120 428.3
Cme11g01575 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 6.3e-120 427.2
Cme08g00160 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.2 8.2e-120 426.8
Cme12g01212 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.2 1.2e-118 422.9
Cme04g01040 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 82.8 8.5e-117 416.8
Cme06g02076 . 5 264 Chloroplast and Mitochondria Gene Families AT2G05070 68.4 2.0e-97 352.4
Cme09g00132 . 71 274 Chloroplast and Mitochondria Gene Families AT2G05070 53.1 7.3e-52 201.1
Cme01g00539 . 1 244 Chloroplast and Mitochondria Gene Families AT2G05100 86.9 5.6e-123 437.6
Cme08g00161 . 78 310 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 2.1e-101 365.9
Cme08g00160 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 2.7e-101 365.5
Cme11g01575 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 4.6e-101 364.8
Cme12g01212 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 3.0e-100 362.1
Cme04g01040 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.7 7.3e-99 357.5
Cme06g02076 . 5 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 2.8e-82 302.4
Cme09g00132 . 71 258 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 2.6e-43 172.9
Cme08g02519 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 7.4e-67 250.4
Cme11g01575 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 5.7e-137 483.8
Cme08g00160 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 2.2e-136 481.9
Cme08g00161 . 74 338 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 8.3e-136 479.9
Cme12g01212 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 2.0e-134 475.3
Cme04g01040 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 83.8 2.3e-125 445.3
Cme01g00539 . 3 272 Chloroplast and Mitochondria Gene Families AT1G29930 76.3 8.9e-114 406.8
Cme06g02076 . 1 264 Chloroplast and Mitochondria Gene Families AT1G29930 65.3 7.8e-94 340.5
Cme09g00132 . 54 274 Chloroplast and Mitochondria Gene Families AT1G29930 50.7 5.1e-53 204.9
Cme11g01575 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 2.2e-136 481.9
Cme08g00160 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 8.3e-136 479.9
Cme08g00161 . 74 338 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 3.1e-135 478.0
Cme12g01212 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 7.7e-134 473.4
Cme04g01040 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 83.8 2.9e-125 444.9
Cme01g00539 . 3 272 Chloroplast and Mitochondria Gene Families AT1G29920 75.9 5.2e-114 407.5
Cme06g02076 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29920 69.4 7.8e-94 340.5
Cme09g00132 . 54 274 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 5.1e-53 204.9
Cme11g01575 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 2.2e-136 481.9
Cme08g00160 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 8.3e-136 479.9
Cme08g00161 . 74 338 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 3.1e-135 478.0
Cme12g01212 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 7.7e-134 473.4
Cme04g01040 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 83.8 2.9e-125 444.9
Cme01g00539 . 3 272 Chloroplast and Mitochondria Gene Families AT1G29910 75.9 5.2e-114 407.5
Cme06g02076 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29910 69.4 7.8e-94 340.5
Cme09g00132 . 54 274 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 5.1e-53 204.9
Cme09g00132 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 84.3 2.1e-137 485.3
Cme04g01040 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 1.6e-57 219.9
Cme08g00160 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 6.1e-57 218.0
Cme12g01212 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 51.6 8.0e-57 217.6
Cme11g01575 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.0e-56 217.2
Cme08g00161 . 122 326 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.4e-56 216.9
Cme01g00539 . 55 260 Chloroplast and Mitochondria Gene Families AT4G10340 52.4 3.2e-53 205.7
Cme06g02076 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 3.5e-52 202.2
Cme11g01575 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.8 3.7e-136 481.1
Cme08g00160 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 9.1e-135 476.5
Cme08g00161 . 74 338 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 3.4e-134 474.6
Cme12g01212 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 3.8e-133 471.1
Cme04g01040 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 84.2 4.5e-126 447.6
Cme01g00539 . 3 272 Chloroplast and Mitochondria Gene Families AT2G34420 75.2 1.8e-114 409.1
Cme06g02076 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34420 69.8 7.8e-94 340.5
Cme08g00161 . 74 338 Chloroplast and Mitochondria Gene Families AT2G34430 89.8 6.7e-138 486.9
Cme08g00160 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 89.5 2.6e-137 485.0
Cme12g01212 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.3e-136 482.6
Cme11g01575 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.4 6.3e-136 480.3
Cme04g01040 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.2 3.7e-128 454.5
Cme01g00539 . 31 272 Chloroplast and Mitochondria Gene Families AT2G34430 81.5 3.7e-112 401.4
Cme06g02076 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 7.8e-94 340.5
Cme08g02519 . 2 284 Chloroplast and Mitochondria Gene Families AT5G01530 84.5 3.9e-139 491.1
Cme06g01704 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.5 3.6e-144 507.7
Cme06g01704 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 86.7 3.0e-150 528.1
Cme11g01725 . 38 405 Chloroplast and Mitochondria Gene Families AT2G30160 65.7 7.8e-136 480.3
Cme08g02177 . 63 365 Chloroplast and Mitochondria Gene Families AT2G30160 65.5 8.4e-114 407.1
Cme11g01725 . 38 408 Chloroplast and Mitochondria Gene Families AT1G07030 65.2 8.5e-135 476.9
Cme08g02177 . 59 365 Chloroplast and Mitochondria Gene Families AT1G07030 68.2 1.3e-119 426.4
Cme01g02233 . 1 341 Chloroplast and Mitochondria Gene Families AT2G47490 68.4 4.6e-130 461.1
Cme09g01426 . 11 320 Chloroplast and Mitochondria Gene Families AT2G47490 58.8 4.1e-102 368.2
Cme09g01426 . 10 315 Chloroplast and Mitochondria Gene Families AT1G25380 64.8 7.8e-113 404.1
Cme01g02233 . 11 333 Chloroplast and Mitochondria Gene Families AT1G25380 57.4 4.0e-101 365.2
Cme11g01086 CCT 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 69.1 1.3e-239 825.9
Cme01g00362 CCT 1 575 Chloroplast and Mitochondria Gene Families AT4G21490 64.4 3.0e-223 771.5
Cme12g01401 . 6 521 Chloroplast and Mitochondria Gene Families AT4G21490 72.3 1.2e-216 749.6
Cme01g02831 . 5 182 Chloroplast and Mitochondria Gene Families AT1G17530 64.6 2.3e-60 228.8
Cme02g01431 . 36 214 Chloroplast and Mitochondria Gene Families AT1G17530 57.5 2.5e-51 198.7
Cme02g01431 . 35 218 Chloroplast and Mitochondria Gene Families AT3G04800 56.2 5.2e-52 201.1
Cme01g02831 . 22 180 Chloroplast and Mitochondria Gene Families AT3G04800 55.9 6.0e-40 161.0
Cme01g02831 . 15 182 Chloroplast and Mitochondria Gene Families AT1G72750 67.6 9.8e-59 223.4
Cme02g01431 . 38 218 Chloroplast and Mitochondria Gene Families AT1G72750 58.7 4.7e-53 204.5
Cme09g00161 . 86 240 Chloroplast and Mitochondria Gene Families AT1G26100 50.6 3.7e-39 158.7
Cme10g00300 . 15 121 Chloroplast and Mitochondria Gene Families AT1G26100 65.4 4.1e-38 155.2
Cme09g00161 . 1 247 Chloroplast and Mitochondria Gene Families AT5G38630 60.4 8.8e-78 287.0
Cme04g00023 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 71.9 1.2e-81 300.1
Cme09g01298 . 5 222 Chloroplast and Mitochondria Gene Families AT1G14730 51.4 1.0e-62 236.9
Cme09g01145 . 9 375 Chloroplast and Mitochondria Gene Families AT5G14040 78.6 2.2e-166 582.0
Cme06g01908 . 10 355 Chloroplast and Mitochondria Gene Families AT5G14040 75.8 1.0e-155 546.6
Cme02g02103 . 28 336 Chloroplast and Mitochondria Gene Families AT5G14040 84.6 7.2e-154 540.4
Cme01g01928 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.7 1.1e-85 313.9
Cme06g01908 . 8 361 Chloroplast and Mitochondria Gene Families AT3G48850 70.5 3.3e-143 505.0
Cme09g01145 . 8 375 Chloroplast and Mitochondria Gene Families AT3G48850 67.8 5.7e-140 494.2
Cme02g02103 . 29 336 Chloroplast and Mitochondria Gene Families AT3G48850 75.3 4.9e-139 491.1
Cme01g01928 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 51.5 2.4e-85 312.8
Cme01g01928 . 14 309 Chloroplast and Mitochondria Gene Families AT2G17270 75.7 7.1e-131 463.8
Cme06g01908 . 62 360 Chloroplast and Mitochondria Gene Families AT2G17270 52.2 5.7e-88 321.2
Cme09g00204 . 16 313 Chloroplast and Mitochondria Gene Families AT5G15640 77.7 6.1e-130 460.7
Cme07g00195 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 68.0 3.2e-124 441.8
Cme01g02825 . 1 259 Chloroplast and Mitochondria Gene Families AT5G26200 57.7 9.7e-73 270.8
Cme07g00195 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.2 3.0e-130 461.8
Cme01g02825 . 1 263 Chloroplast and Mitochondria Gene Families AT1G72820 72.6 1.9e-103 372.9
Cme09g01790 . 78 280 Chloroplast and Mitochondria Gene Families AT5G52570 52.2 2.8e-47 185.7
Cme06g01033 . 67 285 Chloroplast and Mitochondria Gene Families AT4G25700 61.4 3.1e-67 251.9
Cme09g01790 . 65 201 Chloroplast and Mitochondria Gene Families AT4G25700 72.3 5.6e-53 204.5
Cme01g00379 . 101 287 Chloroplast and Mitochondria Gene Families AT4G03320 51.1 6.9e-56 214.5
Cme06g02078 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.7 2.2e-120 429.1
Cme02g01000 . 54 547 Chloroplast and Mitochondria Gene Families AT2G18710 85.9 1.4e-241 832.4
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0004103 4 1 2 3 2 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 2 1 1 1 2 1 0 2 1 1 44
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cme03g00333 Cme_Chr03 FPKM 2.791157 1.694128 0.589986 0.561128 5.081985 5.061244 5.569465 0.0 0.0 0.0