Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cme04g02538 ATGAGCGTGATCGACCTTTTGACCAGAGTAGATGCGATCTGCCAGAAGTACGACAAATATGACATAGAAAAGCAGAGAGATCTCAATGTCTCAGGCGACGATGCCTTCGCTCGTCTCTACGCCACTGTTGAAGCTGACATTGAAGCCGCTTTGCAGAAAGCGGAGGATGCTTCTAAAGAGAAGAATAGGGCATCCGTGGTGGCGTTGAATGCGGAGATTCGTCGTACGAAGGCTCGATTACTGGAGGAAGTTCCCAAGTTGCAGAGGTTGGCTGTAAAGAGGGTTAAAGGGCTATCAACTGAAGATCTTACCACTCGAAATGATTTGGTGCTTGCATTGCCGGATAGGATTCAAGCTATACCAGATGGAACTGTGACTACCACAAAGAATAACGGGGGCTGGACATCCTCAGCTTCACGGACTGAAATCAAATTTGACTCAGATGGGCGGTTTGATGATGAGTACTTCCAACACACTGAGCAGTCTAGTCAGTTCAGGCAGGAGTATGAAATGAGGAAAATGAAGCAGGATCAAGGATTGGACATGATATCAGAAGGGTTGGATACTCTGAAGAATATGGCACATGATATGAATGAGGAAATAGACAGGCAAGTCCCTTTGATGGACGAGATTGACACTAAGGTGGACAAGGCTGCATCTGACCTTAAGAACACCAACGTTAGATTGAAGGACACAGTTAACCAGCTAAGGTCCAGCAGAAATTTCTGTATTGATATCATTTTGTTGTGTATAATCTTGGGGATTGCTGCCTATCTATACAATGTGTTGAAGAAGTGA 798 44.99 MSVIDLLTRVDAICQKYDKYDIEKQRDLNVSGDDAFARLYATVEADIEAALQKAEDASKEKNRASVVALNAEIRRTKARLLEEVPKLQRLAVKRVKGLSTEDLTTRNDLVLALPDRIQAIPDGTVTTTKNNGGWTSSASRTEIKFDSDGRFDDEYFQHTEQSSQFRQEYEMRKMKQDQGLDMISEGLDTLKNMAHDMNEEIDRQVPLMDEIDTKVDKAASDLKNTNVRLKDTVNQLRSSRNFCIDIILLCIILGIAAYLYNVLKK 265
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 31617184 31620951 - MELO3C009331.2.1 Cme04g02538 326799

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cme04g02538 265 Gene3D - 170 231 - -
Cme04g02538 265 Pfam SNARE domain 207 256 IPR000727 -
Cme04g02538 265 CDD SNARE_Qc 175 230 - -
Cme04g02538 265 PANTHER SYNTAXIN 1 261 IPR045242 -
Cme04g02538 265 SUPERFAMILY SNARE fusion complex 165 230 - -
Cme04g02538 265 ProSitePatterns Syntaxin / epimorphin family signature. 176 215 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cme04g02538 265 SMART tSNARE_6 165 232 IPR000727 -
Cme04g02538 265 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 170 232 IPR000727 -
Cme04g02538 265 PANTHER SYNTAXIN-73 1 261 - -
Cme04g02538 265 Coils Coil 40 60 - -
Cme04g02538 265 Coils Coil 219 239 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cme04g02538 K08506 SYP7; syntaxin of plants SYP7 - csv:101215905 504.597
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cme04g02538 Cme-Chr4:31617184 Cme11g01790 Cme-Chr11:26079597 9.14E-109 dispersed
Cme04g02538 Cme-Chr4:31617184 Cme04g02539 Cme-Chr4:31617200 0 tandem
Cme11g01789 Cme-Chr11:26079179 Cme04g02538 Cme-Chr4:31617184 3.47E-40 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g590 . . . . Bpe04g01584 . . . . Cmo14g00195 . . . . . . . . . . . . . . . . . . . . . . . Cone13ag1275 Cone19ag1262 . . . Cme04g02538 . . . . . . . . Sed04g1347 . . . Cma14g00203 . Car14g00181 Cpe03g00174 . Bhi11g02112 Tan08g1893 Cmetu04g1845 Lac10g3026 Hepe05g0250 . . Cla10g01938 Cam10g2004 Cec10g2046 Cco10g2031 Clacu10g2011 Cmu10g2760 Cre10g2153 Lsi03g02035 Csa03g03265 Chy04g02075 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cme03g01671 . 8 338 SNARE and Associated Proteins AT3G24350 64.5 2.8e-102 369.0
Cme08g02007 CCT 1 309 SNARE and Associated Proteins AT1G08560 68.8 6.5e-100 360.9
Cme04g02317 . 22 280 SNARE and Associated Proteins AT3G11820 80.3 6.1e-114 407.5
Cme08g01151 . 90 349 SNARE and Associated Proteins AT3G11820 70.0 6.6e-100 360.9
Cme12g01397 . 31 281 SNARE and Associated Proteins AT3G11820 65.3 1.1e-91 333.6
Cme04g01796 CCT 30 282 SNARE and Associated Proteins AT3G11820 52.2 9.6e-67 250.8
Cme04g02317 . 31 280 SNARE and Associated Proteins AT3G52400 68.8 2.3e-90 329.3
Cme08g01151 . 67 349 SNARE and Associated Proteins AT3G52400 59.8 1.9e-84 309.7
Cme12g01397 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 5.7e-81 298.1
Cme12g01397 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 5.4e-107 384.4
Cme04g02317 . 1 285 SNARE and Associated Proteins AT4G03330 56.6 5.4e-83 304.7
Cme08g01151 . 67 347 SNARE and Associated Proteins AT4G03330 54.8 1.1e-78 290.4
Cme04g01796 CCT 1 282 SNARE and Associated Proteins AT4G03330 51.4 1.7e-68 256.5
Cme12g01397 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 1.6e-127 452.6
Cme04g02317 . 1 285 SNARE and Associated Proteins AT1G61290 61.3 9.2e-91 330.5
Cme08g01151 . 67 365 SNARE and Associated Proteins AT1G61290 54.5 1.5e-80 296.6
Cme12g01397 . 1 299 SNARE and Associated Proteins AT1G11250 77.9 2.8e-124 441.8
Cme04g02317 . 1 285 SNARE and Associated Proteins AT1G11250 61.8 2.8e-92 335.5
Cme08g01151 . 67 361 SNARE and Associated Proteins AT1G11250 54.6 3.1e-83 305.4
Cme04g01796 CCT 1 305 SNARE and Associated Proteins AT3G03800 73.3 4.6e-114 407.9
Cme11g00777 . 48 325 SNARE and Associated Proteins AT3G03800 52.9 1.3e-73 273.5
Cme04g01796 CCT 1 200 SNARE and Associated Proteins AT5G08080 79.0 5.7e-82 300.8
Cme11g00777 . 30 224 SNARE and Associated Proteins AT5G08080 53.3 1.4e-43 173.3
Cme06g02454 . 1 256 SNARE and Associated Proteins AT5G16830 58.8 8.5e-75 277.3
Cme06g02454 . 1 256 SNARE and Associated Proteins AT5G46860 65.6 1.4e-79 293.1
Cme06g02454 . 1 256 SNARE and Associated Proteins AT4G17730 60.9 6.8e-74 274.2
Cme06g02454 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 4.3e-52 202.2
Cme10g01057 . 1 336 SNARE and Associated Proteins AT5G05760 64.7 3.4e-110 395.2
Cme03g01671 . 8 338 SNARE and Associated Proteins AT3G24350 64.5 2.8e-102 369.0
Cme05g01576 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 5.5e-126 447.6
Cme01g02227 . 1 302 SNARE and Associated Proteins AT5G26980 66.0 3.1e-97 352.1
Cme05g01576 . 1 329 SNARE and Associated Proteins AT4G02195 63.7 3.5e-104 375.2
Cme01g02227 . 1 302 SNARE and Associated Proteins AT4G02195 67.3 1.8e-100 362.8
Cme05g01576 . 1 328 SNARE and Associated Proteins AT3G05710 74.8 7.9e-128 453.8
Cme01g02227 . 1 302 SNARE and Associated Proteins AT3G05710 63.1 6.3e-93 337.8
Cme01g00994 . 1 233 SNARE and Associated Proteins AT1G16240 73.8 2.4e-91 332.0
Cme06g02818 . 4 220 SNARE and Associated Proteins AT1G16240 65.3 1.9e-72 269.2
Cme01g00994 . 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.2e-89 326.6
Cme06g02818 . 4 220 SNARE and Associated Proteins AT1G79590 65.3 4.4e-73 271.6
Cme11g02501 . 56 246 SNARE and Associated Proteins AT1G28490 71.7 1.4e-66 249.6
Cme04g02538 . 1 264 SNARE and Associated Proteins AT3G09740 78.6 4.9e-112 401.0
Cme04g02539 . 1 264 SNARE and Associated Proteins AT3G09740 78.6 4.9e-112 401.0
Cme11g01790 . 1 235 SNARE and Associated Proteins AT3G09740 66.2 5.4e-79 291.2
Cme04g02538 . 1 264 SNARE and Associated Proteins AT3G45280 64.8 1.1e-87 320.1
Cme04g02539 . 1 264 SNARE and Associated Proteins AT3G45280 64.8 1.1e-87 320.1
Cme11g01790 . 1 237 SNARE and Associated Proteins AT3G45280 64.0 2.8e-75 278.9
Cme04g02538 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 6.9e-95 344.0
Cme04g02539 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 6.9e-95 344.0
Cme11g01790 . 1 235 SNARE and Associated Proteins AT3G61450 60.6 1.4e-74 276.6
Cme03g00216 . 65 308 SNARE and Associated Proteins AT1G51740 74.0 1.2e-93 339.7
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cme04g02538 Cme_Chr04 FPKM 56.943356 60.494778 14.022632 14.818709 20.597467 15.530334 16.269842 24.850908 21.526209 26.328955