Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cmetu02g0368 ATGGCCACTGTCACCACTCAAGCTTCTGCCGCCGTTTTCCGGCCATGTGCCGCCCGATCAAGATTCCTTTCCGGTTCTTCCGGTAAACTCCACCGTGTGCTCTCAGTTAAGCCAGTCTCTGCTTCTTCGTCTTCATCTTTCAAGGTTGAAGCCAAGAAAGGAGAATGGTTGCCTGGTCTCCCATCTCCGGCGTACTTAAACGGCAGTCTTCCCGGCGACAATGGATTTGACCCATTGGGATTAGCGGAAGACCCAGAGAATTTGAGGTGGTATGTTCAAGCGGAGCTGGTGAATGGGCGGTGGGCGATGCTGGGTGTCGCCGGAATGCTTCTACCGGAGGTTTTCACAAAGATCGGAATCATCAACGCCCCTCAATGGTACGATGCCGGGAAGGCAGAGTACTTCGCCTCATCGTCAACTCTATTCGTAATCGAGTTTATCCTCTTCCATTACGTCGAAATCCGAAGATGGCAAGACATTAAAAACCCTGGCTGTGTTAACCAAGACCCCATTTTTAAGCAATACAGTTTGCCCCCAAATGAATGTGGTTACCCTGGTGGGATTTTCAATCCCCTGAATTTCGCCCCCACTCTTGAAGCTAAAGAGAAGGAAATAGCCAATGGGAGACTTGCGATGTTGGCGTTTTTGGGGTTCATAGTGCAACACAATGTGACAGGAAAAGGGCCATTTGACAATCTTTTGCAGCACATCTCAGACCCATGGCACAACACCATTGTCCAGACATTTGGTGGCAACTAA 759 49.67 MATVTTQASAAVFRPCAARSRFLSGSSGKLHRVLSVKPVSASSSSSFKVEAKKGEWLPGLPSPAYLNGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLLPEVFTKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKQYSLPPNECGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIVQTFGGN 252
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 23721506 23723130 - PI0024353.1 Cmetu02g0368 348380

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cmetu02g0368 252 Gene3D Chlorophyll a/b binding protein domain 63 242 - -
Cmetu02g0368 252 FunFam Chlorophyll a-b binding protein, chloroplastic 63 242 - -
Cmetu02g0368 252 Pfam Chlorophyll A-B binding protein 63 222 IPR022796 -
Cmetu02g0368 252 SUPERFAMILY Chlorophyll a-b binding protein 53 249 - -
Cmetu02g0368 252 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 19 248 IPR001344 GO:0009765|GO:0016020
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmetu02g0368 K08910 - - csv:101222701 497.278
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmetu02g0368 Cmetu-Chr2:23721506 Cmetu03g1729 Cmetu-Chr3:1357546 4.80E-54 dispersed
Cmetu09g0209 Cmetu-Chr9:17169120 Cmetu02g0368 Cmetu-Chr2:23721506 3.30E-39 transposed
Cmetu12g1815 Cmetu-Chr12:521661 Cmetu02g0368 Cmetu-Chr2:23721506 1.80E-133 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi17g566 Blo04g00773 . Bda06g00542 Bda15g00608 Bpe12g00541 . . Bma12g00994 . . . Cma11g00139 Car10g00187 Car11g00156 . . Cpe04g01495 . . . . . . . Cla06g01586 Cam06g1755 Cec06g1811 Cco06g1814 Clacu06g1721 Cmu06g1664 Cre06g2478 Cone2ag0840 Cone16ag0175 . . Lsi02g00081 Csa01g00560 Chy12g01533 Cme12g01983 Blo13g00003 Blo15g00312 . . Bpe07g00779 . . Bma08g00227 Sed08g2078 Cmo10g00213 Cmo11g00172 . . . . . Cpe18g00788 Bhi08g01147 Tan05g2431 Cmetu02g0368 Lac10g0087 Hepe07g2501 . . Cla04g01190 Cam04g1247 Cec01g1758 Cco01g1804 Clacu04g1276 Cmu04g1254 Cre01g1547 . Csa01g00241 Chy02g02491 Cme02g01877
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmetu12g1488 . 1 388 Chloroplast and Mitochondria Gene Families AT2G28800 65.9 6.6e-136 481.1
Cmetu03g0657 . 71 425 Chloroplast and Mitochondria Gene Families AT2G28800 55.4 6.4e-99 358.2
Cmetu03g1826 . 3 209 Chloroplast and Mitochondria Gene Families AT1G15820 78.5 3.2e-93 338.6
Cmetu01g1261 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.5 1.3e-143 506.1
Cmetu11g2118 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 7.0e-121 430.6
Cmetu04g1559 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 9.2e-121 430.3
Cmetu04g0833 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 9.2e-121 430.3
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.1 6.0e-120 427.6
Cmetu12g1325 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 2.3e-119 425.6
Cmetu04g0179 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.9 5.6e-118 421.0
Cmetu06g0565 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 67.4 1.3e-98 356.7
Cmetu07g0171 . 120 336 Chloroplast and Mitochondria Gene Families AT3G27690 50.7 6.3e-53 204.9
Cmetu09g0513 . 69 272 Chloroplast and Mitochondria Gene Families AT3G27690 52.6 1.2e-51 200.7
Cmetu02g0801 . 42 250 Chloroplast and Mitochondria Gene Families AT3G61470 64.1 1.2e-84 310.1
Cmetu10g0959 . 36 214 Chloroplast and Mitochondria Gene Families AT3G61470 70.2 7.0e-69 257.7
Cmetu02g0368 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 8.9e-64 240.7
Cmetu09g0209 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.1 2.7e-90 328.6
Cmetu08g1554 . 3 284 Chloroplast and Mitochondria Gene Families AT3G08940 83.4 1.3e-135 479.6
Cmetu07g0171 . 55 343 Chloroplast and Mitochondria Gene Families AT1G76570 79.9 7.2e-143 503.8
Cmetu02g2047 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.4 1.9e-136 482.3
Cmetu01g1261 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 2.0e-143 505.4
Cmetu04g1559 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 3.1e-120 428.3
Cmetu04g0833 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 3.1e-120 428.3
Cmetu11g2118 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 6.9e-120 427.2
Cmetu12g0190 . 6 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 1.5e-119 426.0
Cmetu12g1325 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.2 2.6e-119 425.2
Cmetu04g0179 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 83.7 1.9e-117 419.1
Cmetu06g0565 . 8 264 Chloroplast and Mitochondria Gene Families AT2G05070 68.8 6.7e-99 357.5
Cmetu01g1261 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.1e-124 443.4
Cmetu12g0190 . 6 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 7.8e-102 367.5
Cmetu04g1559 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 2.3e-101 365.9
Cmetu04g0833 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 2.3e-101 365.9
Cmetu12g1325 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.0e-101 364.8
Cmetu11g2118 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 5.0e-101 364.8
Cmetu04g0179 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 1.6e-99 359.8
Cmetu06g0565 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 68.1 1.6e-83 306.6
Cmetu09g0513 . 69 256 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 2.8e-43 172.9
Cmetu08g1554 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 8.1e-67 250.4
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 6.3e-137 483.8
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 1.5e-135 479.2
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 1.5e-135 479.2
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 86.9 1.3e-134 476.1
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 1.9e-133 472.2
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.5 5.0e-126 447.6
Cmetu01g1261 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.7 2.1e-116 415.6
Cmetu06g0565 . 11 264 Chloroplast and Mitochondria Gene Families AT1G29930 67.8 1.0e-94 343.6
Cmetu09g0513 . 52 272 Chloroplast and Mitochondria Gene Families AT1G29930 50.7 3.3e-53 205.7
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 2.4e-136 481.9
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 5.9e-135 477.2
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 5.9e-135 477.2
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.5 5.0e-134 474.2
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 7.2e-133 470.3
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.5 6.5e-126 447.2
Cmetu01g1261 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 78.3 1.6e-116 416.0
Cmetu06g0565 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29920 70.2 1.0e-94 343.6
Cmetu09g0513 . 52 272 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 3.3e-53 205.7
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 2.4e-136 481.9
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 5.9e-135 477.2
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 5.9e-135 477.2
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.5 5.0e-134 474.2
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 7.2e-133 470.3
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.5 6.5e-126 447.2
Cmetu01g1261 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 78.3 1.6e-116 416.0
Cmetu06g0565 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29910 70.2 1.0e-94 343.6
Cmetu09g0513 . 52 272 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 3.3e-53 205.7
Cmetu09g0513 . 11 287 Chloroplast and Mitochondria Gene Families AT4G10340 85.1 2.3e-137 485.3
Cmetu12g1325 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 2.3e-57 219.5
Cmetu04g1559 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.7e-57 218.0
Cmetu04g0833 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.7e-57 218.0
Cmetu12g0190 . 39 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.7e-57 218.0
Cmetu04g0179 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 8.8e-57 217.6
Cmetu11g2118 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cmetu01g1261 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 3.1e-54 209.1
Cmetu06g0565 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 2.2e-52 203.0
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.8 4.0e-136 481.1
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 6.5e-134 473.8
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 6.5e-134 473.8
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.5 2.5e-133 471.9
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 3.5e-132 468.0
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 84.9 1.0e-126 449.9
Cmetu01g1261 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.5 5.5e-117 417.5
Cmetu06g0565 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34420 70.7 1.0e-94 343.6
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 2.8e-137 485.0
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.7 8.2e-137 483.4
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.7 8.2e-137 483.4
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.4 6.9e-136 480.3
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 3.4e-135 478.0
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.2 1.4e-128 456.1
Cmetu01g1261 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.6 5.2e-115 411.0
Cmetu06g0565 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 71.4 1.0e-94 343.6
Cmetu08g1554 . 2 284 Chloroplast and Mitochondria Gene Families AT5G01530 84.5 4.3e-139 491.1
Cmetu06g0745 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.5 3.3e-143 504.6
Cmetu06g0745 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.7 2.6e-150 528.5
Cmetu11g0163 . 5 324 Chloroplast and Mitochondria Gene Families AT2G30160 75.4 1.2e-142 503.1
Cmetu08g1077 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 65.2 1.3e-112 403.3
Cmetu11g0163 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 75.5 1.8e-141 499.2
Cmetu08g1077 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 68.2 2.5e-119 425.6
Cmetu01g1850 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 1.1e-135 479.9
Cmetu09g1187 . 11 312 Chloroplast and Mitochondria Gene Families AT2G47490 64.6 3.7e-112 401.7
Cmetu09g1187 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 64.0 4.9e-124 441.4
Cmetu01g1850 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.5 9.2e-107 384.0
Cmetu12g0551 . 6 568 Chloroplast and Mitochondria Gene Families AT4G21490 71.6 2.2e-243 838.6
Cmetu11g0692 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 69.3 5.9e-241 830.5
Cmetu01g0312 . 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.5 5.9e-225 777.3
Cmetu01g2125 . 5 185 Chloroplast and Mitochondria Gene Families AT1G17530 65.2 7.8e-62 233.8
Cmetu02g1778 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 58.4 2.1e-51 199.1
Cmetu02g1778 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 59.0 2.8e-51 198.7
Cmetu01g2125 . 22 181 Chloroplast and Mitochondria Gene Families AT3G04800 55.6 3.9e-40 161.8
Cmetu01g2125 . 15 185 Chloroplast and Mitochondria Gene Families AT1G72750 68.2 4.4e-60 228.0
Cmetu02g1778 . 10 183 Chloroplast and Mitochondria Gene Families AT1G72750 59.9 8.8e-53 203.8
Cmetu10g1760 . 1 223 Chloroplast and Mitochondria Gene Families AT1G26100 62.8 3.7e-72 268.5
Cmetu09g1595 . 1 211 Chloroplast and Mitochondria Gene Families AT5G38630 66.1 2.5e-81 298.9
Cmetu04g1101 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 73.5 2.1e-82 302.8
Cmetu09g1860 . 5 222 Chloroplast and Mitochondria Gene Families AT1G14730 51.4 1.3e-63 240.0
Cmetu09g0229 . 9 353 Chloroplast and Mitochondria Gene Families AT5G14040 82.6 6.0e-170 594.0
Cmetu02g1106 . 26 334 Chloroplast and Mitochondria Gene Families AT5G14040 84.3 1.1e-152 536.6
Cmetu06g1238 . 10 364 Chloroplast and Mitochondria Gene Families AT5G14040 73.4 1.1e-152 536.6
Cmetu01g2526 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.4 1.7e-84 310.1
Cmetu09g0229 . 8 353 Chloroplast and Mitochondria Gene Families AT3G48850 71.2 8.0e-143 503.8
Cmetu06g1238 . 8 357 Chloroplast and Mitochondria Gene Families AT3G48850 69.0 1.5e-141 499.6
Cmetu02g1106 . 27 334 Chloroplast and Mitochondria Gene Families AT3G48850 75.0 4.5e-138 488.0
Cmetu01g2526 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 6.4e-84 308.1
Cmetu01g2526 . 14 309 Chloroplast and Mitochondria Gene Families AT2G17270 76.7 7.0e-132 467.2
Cmetu06g1238 . 64 362 Chloroplast and Mitochondria Gene Families AT2G17270 51.5 2.0e-86 316.2
Cmetu09g0229 . 63 353 Chloroplast and Mitochondria Gene Families AT2G17270 52.2 6.5e-85 311.2
Cmetu09g1846 . 16 313 Chloroplast and Mitochondria Gene Families AT5G15640 77.1 2.6e-129 458.8
Cmetu06g0327 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.3 1.9e-79 293.1
Cmetu07g1161 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 68.3 1.4e-125 446.4
Cmetu01g1512 . 1 347 Chloroplast and Mitochondria Gene Families AT5G26200 57.3 8.1e-105 377.5
Cmetu01g1512 . 1 351 Chloroplast and Mitochondria Gene Families AT1G72820 74.6 1.9e-146 515.8
Cmetu07g1161 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.2 5.7e-130 461.1
Cmetu09g1164 . 78 283 Chloroplast and Mitochondria Gene Families AT5G52570 51.0 2.8e-48 189.1
Cmetu06g0550 . 67 285 Chloroplast and Mitochondria Gene Families AT4G25700 63.7 2.8e-69 258.8
Cmetu09g1164 . 65 200 Chloroplast and Mitochondria Gene Families AT4G25700 70.6 3.1e-52 202.2
Cmetu01g1793 . 137 315 Chloroplast and Mitochondria Gene Families AT4G03320 52.8 1.2e-56 217.2
Cmetu06g1203 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 80.3 1.3e-121 433.3
Cmetu02g0080 . 35 544 Chloroplast and Mitochondria Gene Families AT2G18710 83.8 3.0e-242 834.7
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001994 2 2 3 3 2 2 3 2 2 2 2 2 3 2 2 3 2 2 3 2 2 2 2 2 2 2 2 3 2 1 66