Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cmetu02g1778 ATGGAAGGTTCCTCCCAATCACCCGATGATCGGAAAACCCGTTTCTATCACCCTTACCAAGACCTACACGTTCCGATCACCAAGCTCTACGAGCTCCCCACCGCCCCTGAGCATCTTTTCTTCGAAGAAGCCGCCAGGCCTCACCGTTCTTGGGGCGAAAACCTCCAATACTATACCGGAATTGGCTACCTCTCCGGCGCCCTTCTCGGCGGCGCCAGGGGTTCCATTCAAGGCCTCAGGGCAGCTGAGCCCGGTGACTCTGTTAAACTCCGTCTCAATCGAGTTCTCAACTCTGGGGGCCAGGTTGGCCGGAGGGCTGGAAACTCTCTTGGGATCCTTGGCTTGATTTTTGCTGGTTTGGAAAGTGGGGTTATTCATTTGAGAGGTTCTGATGATGTTTTGAACAGTATTGTAGCTGGATTGGGGACTGGTGCTGTTTATAAGGCGGCGTCTGGGCCAAGGTCGGCCGCCATCGCCGGTGCTATTGGAGGGATTGCTGCTGCAGCTGCAGTTGCGGGTAAGCAGGCAGTCAAGAGATATGTGCCGATATAG 552 54.89 MEGSSQSPDDRKTRFYHPYQDLHVPITKLYELPTAPEHLFFEEAARPHRSWGENLQYYTGIGYLSGALLGGARGSIQGLRAAEPGDSVKLRLNRVLNSGGQVGRRAGNSLGILGLIFAGLESGVIHLRGSDDVLNSIVAGLGTGAVYKAASGPRSAAIAGAIGGIAAAAAVAGKQAVKRYVPI 183
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
2 14423798 14425276 - PI0018747.1 Cmetu02g1778 349790

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cmetu02g1778 183 Pfam Tim17/Tim22/Tim23/Pmp24 family 57 165 - -
Cmetu02g1778 183 PANTHER TIM23 28 171 IPR045238 GO:0022857
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmetu02g1778 K17794 - - csv:116401801 313.153
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmetu01g2125 Cmetu-Chr1:28678682 Cmetu02g1778 Cmetu-Chr2:14423798 6.10E-47 dispersed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmetu12g1488 . 1 388 Chloroplast and Mitochondria Gene Families AT2G28800 65.9 6.6e-136 481.1
Cmetu03g0657 . 71 425 Chloroplast and Mitochondria Gene Families AT2G28800 55.4 6.4e-99 358.2
Cmetu03g1826 . 3 209 Chloroplast and Mitochondria Gene Families AT1G15820 78.5 3.2e-93 338.6
Cmetu01g1261 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.5 1.3e-143 506.1
Cmetu11g2118 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 7.0e-121 430.6
Cmetu04g1559 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 9.2e-121 430.3
Cmetu04g0833 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 9.2e-121 430.3
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.1 6.0e-120 427.6
Cmetu12g1325 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.0 2.3e-119 425.6
Cmetu04g0179 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.9 5.6e-118 421.0
Cmetu06g0565 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 67.4 1.3e-98 356.7
Cmetu07g0171 . 120 336 Chloroplast and Mitochondria Gene Families AT3G27690 50.7 6.3e-53 204.9
Cmetu09g0513 . 69 272 Chloroplast and Mitochondria Gene Families AT3G27690 52.6 1.2e-51 200.7
Cmetu02g0801 . 42 250 Chloroplast and Mitochondria Gene Families AT3G61470 64.1 1.2e-84 310.1
Cmetu10g0959 . 36 214 Chloroplast and Mitochondria Gene Families AT3G61470 70.2 7.0e-69 257.7
Cmetu02g0368 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 8.9e-64 240.7
Cmetu09g0209 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 82.1 2.7e-90 328.6
Cmetu08g1554 . 3 284 Chloroplast and Mitochondria Gene Families AT3G08940 83.4 1.3e-135 479.6
Cmetu07g0171 . 55 343 Chloroplast and Mitochondria Gene Families AT1G76570 79.9 7.2e-143 503.8
Cmetu02g2047 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.4 1.9e-136 482.3
Cmetu01g1261 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 2.0e-143 505.4
Cmetu04g1559 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 3.1e-120 428.3
Cmetu04g0833 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 3.1e-120 428.3
Cmetu11g2118 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 6.9e-120 427.2
Cmetu12g0190 . 6 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 1.5e-119 426.0
Cmetu12g1325 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.2 2.6e-119 425.2
Cmetu04g0179 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 83.7 1.9e-117 419.1
Cmetu06g0565 . 8 264 Chloroplast and Mitochondria Gene Families AT2G05070 68.8 6.7e-99 357.5
Cmetu01g1261 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.1e-124 443.4
Cmetu12g0190 . 6 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 7.8e-102 367.5
Cmetu04g1559 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 2.3e-101 365.9
Cmetu04g0833 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 2.3e-101 365.9
Cmetu12g1325 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.0e-101 364.8
Cmetu11g2118 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 77.4 5.0e-101 364.8
Cmetu04g0179 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 1.6e-99 359.8
Cmetu06g0565 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 68.1 1.6e-83 306.6
Cmetu09g0513 . 69 256 Chloroplast and Mitochondria Gene Families AT2G05100 51.8 2.8e-43 172.9
Cmetu08g1554 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 8.1e-67 250.4
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 6.3e-137 483.8
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 1.5e-135 479.2
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 1.5e-135 479.2
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 86.9 1.3e-134 476.1
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 1.9e-133 472.2
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.5 5.0e-126 447.6
Cmetu01g1261 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.7 2.1e-116 415.6
Cmetu06g0565 . 11 264 Chloroplast and Mitochondria Gene Families AT1G29930 67.8 1.0e-94 343.6
Cmetu09g0513 . 52 272 Chloroplast and Mitochondria Gene Families AT1G29930 50.7 3.3e-53 205.7
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 2.4e-136 481.9
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 5.9e-135 477.2
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 5.9e-135 477.2
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.5 5.0e-134 474.2
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 7.2e-133 470.3
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.5 6.5e-126 447.2
Cmetu01g1261 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 78.3 1.6e-116 416.0
Cmetu06g0565 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29920 70.2 1.0e-94 343.6
Cmetu09g0513 . 52 272 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 3.3e-53 205.7
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 2.4e-136 481.9
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 5.9e-135 477.2
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 5.9e-135 477.2
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.5 5.0e-134 474.2
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 7.2e-133 470.3
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.5 6.5e-126 447.2
Cmetu01g1261 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 78.3 1.6e-116 416.0
Cmetu06g0565 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29910 70.2 1.0e-94 343.6
Cmetu09g0513 . 52 272 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 3.3e-53 205.7
Cmetu09g0513 . 11 287 Chloroplast and Mitochondria Gene Families AT4G10340 85.1 2.3e-137 485.3
Cmetu12g1325 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 2.3e-57 219.5
Cmetu04g1559 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.7e-57 218.0
Cmetu04g0833 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.7e-57 218.0
Cmetu12g0190 . 39 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 6.7e-57 218.0
Cmetu04g0179 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 8.8e-57 217.6
Cmetu11g2118 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cmetu01g1261 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 3.1e-54 209.1
Cmetu06g0565 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 2.2e-52 203.0
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.8 4.0e-136 481.1
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 6.5e-134 473.8
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 6.5e-134 473.8
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.5 2.5e-133 471.9
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 3.5e-132 468.0
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 84.9 1.0e-126 449.9
Cmetu01g1261 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.5 5.5e-117 417.5
Cmetu06g0565 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34420 70.7 1.0e-94 343.6
Cmetu12g1325 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 2.8e-137 485.0
Cmetu04g1559 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.7 8.2e-137 483.4
Cmetu04g0833 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.7 8.2e-137 483.4
Cmetu11g2118 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.4 6.9e-136 480.3
Cmetu12g0190 . 3 267 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 3.4e-135 478.0
Cmetu04g0179 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.2 1.4e-128 456.1
Cmetu01g1261 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.6 5.2e-115 411.0
Cmetu06g0565 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 71.4 1.0e-94 343.6
Cmetu08g1554 . 2 284 Chloroplast and Mitochondria Gene Families AT5G01530 84.5 4.3e-139 491.1
Cmetu06g0745 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.5 3.3e-143 504.6
Cmetu06g0745 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 85.7 2.6e-150 528.5
Cmetu11g0163 . 5 324 Chloroplast and Mitochondria Gene Families AT2G30160 75.4 1.2e-142 503.1
Cmetu08g1077 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 65.2 1.3e-112 403.3
Cmetu11g0163 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 75.5 1.8e-141 499.2
Cmetu08g1077 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 68.2 2.5e-119 425.6
Cmetu01g1850 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 1.1e-135 479.9
Cmetu09g1187 . 11 312 Chloroplast and Mitochondria Gene Families AT2G47490 64.6 3.7e-112 401.7
Cmetu09g1187 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 64.0 4.9e-124 441.4
Cmetu01g1850 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.5 9.2e-107 384.0
Cmetu12g0551 . 6 568 Chloroplast and Mitochondria Gene Families AT4G21490 71.6 2.2e-243 838.6
Cmetu11g0692 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 69.3 5.9e-241 830.5
Cmetu01g0312 . 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.5 5.9e-225 777.3
Cmetu01g2125 . 5 185 Chloroplast and Mitochondria Gene Families AT1G17530 65.2 7.8e-62 233.8
Cmetu02g1778 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 58.4 2.1e-51 199.1
Cmetu02g1778 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 59.0 2.8e-51 198.7
Cmetu01g2125 . 22 181 Chloroplast and Mitochondria Gene Families AT3G04800 55.6 3.9e-40 161.8
Cmetu01g2125 . 15 185 Chloroplast and Mitochondria Gene Families AT1G72750 68.2 4.4e-60 228.0
Cmetu02g1778 . 10 183 Chloroplast and Mitochondria Gene Families AT1G72750 59.9 8.8e-53 203.8
Cmetu10g1760 . 1 223 Chloroplast and Mitochondria Gene Families AT1G26100 62.8 3.7e-72 268.5
Cmetu09g1595 . 1 211 Chloroplast and Mitochondria Gene Families AT5G38630 66.1 2.5e-81 298.9
Cmetu04g1101 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 73.5 2.1e-82 302.8
Cmetu09g1860 . 5 222 Chloroplast and Mitochondria Gene Families AT1G14730 51.4 1.3e-63 240.0
Cmetu09g0229 . 9 353 Chloroplast and Mitochondria Gene Families AT5G14040 82.6 6.0e-170 594.0
Cmetu02g1106 . 26 334 Chloroplast and Mitochondria Gene Families AT5G14040 84.3 1.1e-152 536.6
Cmetu06g1238 . 10 364 Chloroplast and Mitochondria Gene Families AT5G14040 73.4 1.1e-152 536.6
Cmetu01g2526 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.4 1.7e-84 310.1
Cmetu09g0229 . 8 353 Chloroplast and Mitochondria Gene Families AT3G48850 71.2 8.0e-143 503.8
Cmetu06g1238 . 8 357 Chloroplast and Mitochondria Gene Families AT3G48850 69.0 1.5e-141 499.6
Cmetu02g1106 . 27 334 Chloroplast and Mitochondria Gene Families AT3G48850 75.0 4.5e-138 488.0
Cmetu01g2526 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 6.4e-84 308.1
Cmetu01g2526 . 14 309 Chloroplast and Mitochondria Gene Families AT2G17270 76.7 7.0e-132 467.2
Cmetu06g1238 . 64 362 Chloroplast and Mitochondria Gene Families AT2G17270 51.5 2.0e-86 316.2
Cmetu09g0229 . 63 353 Chloroplast and Mitochondria Gene Families AT2G17270 52.2 6.5e-85 311.2
Cmetu09g1846 . 16 313 Chloroplast and Mitochondria Gene Families AT5G15640 77.1 2.6e-129 458.8
Cmetu06g0327 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.3 1.9e-79 293.1
Cmetu07g1161 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 68.3 1.4e-125 446.4
Cmetu01g1512 . 1 347 Chloroplast and Mitochondria Gene Families AT5G26200 57.3 8.1e-105 377.5
Cmetu01g1512 . 1 351 Chloroplast and Mitochondria Gene Families AT1G72820 74.6 1.9e-146 515.8
Cmetu07g1161 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.2 5.7e-130 461.1
Cmetu09g1164 . 78 283 Chloroplast and Mitochondria Gene Families AT5G52570 51.0 2.8e-48 189.1
Cmetu06g0550 . 67 285 Chloroplast and Mitochondria Gene Families AT4G25700 63.7 2.8e-69 258.8
Cmetu09g1164 . 65 200 Chloroplast and Mitochondria Gene Families AT4G25700 70.6 3.1e-52 202.2
Cmetu01g1793 . 137 315 Chloroplast and Mitochondria Gene Families AT4G03320 52.8 1.2e-56 217.2
Cmetu06g1203 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 80.3 1.3e-121 433.3
Cmetu02g0080 . 35 544 Chloroplast and Mitochondria Gene Families AT2G18710 83.8 3.0e-242 834.7
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0011351 1 1 1 0 1 1 2 1 1 1 1 1 2 1 1 2 1 0 2 1 1 1 1 1 1 1 0 1 1 1 31