Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cmetu04g2079 ATGAACGATTTATTCTCCTCTCGCTCCTTTTCCCGCGACACCCATGTCGTTGAAATGGGCAACAACGCCTCCTCTTCCCCCACTGCTGTTAATCTCGACAAGTTCTTTGAAGATGTTGAGTCTGTTAAAGACGAGCTCAAGGAGCTTGAACGACTTTACTCCAGCCTTCATGACTCCCATGAACAGAGCAAGACCCTTCACAATGCTAAGGCTGTCAAGGACCTCCGATCTCGCATGGATTCTGATGTTTCCCTTGCTCTTAAGAAGGCTAAACTCATTAAGGTCCGATTGGAGGCTCTTGATCGCTCCAATGCTGCCAATCGGAGCCTCCCTGGTTGTGGTCCTGGTTCCTCTTCTGACCGGACTCGGACTTCTGTAGTCAACGGTTTGAGGAAGAAATTGCAGGATTCTATGGAGAGTTTTAACAATCTTAGGCAACAGATCTCCTCTGAGTACAGGGAGACCGTTCAGCGAAGATATTACACTGTTACTGGTGAAAATCCGGACGAGAAAACCATTGATGTCTTGATATCTACAGGTGAAAGTGAGACATTCTTGCAGAAAGCCATTCAAGAACAAGGTAGAGGCAGAATCTTAGACACCATCAGTGAGATCCAGGAGAGGCATGATGCTGTAAAAGACCTGGAAAGGAACCTCAAAGAGCTGCACCAGGTTTTCATGGACATGGCAGTTTTAGTGCACGAACAAGGCGAGAAACTCGATGACATCGAAAGCCAAGTGAACAGGGCTCATTCTTTTGTTCGAGGTGGCACGCAGGAGTTGACAACAGCCAGAGTATACCAGAAAAACACCCGGAAATGGACAATTATTGCCATCATCATTGTGCTGCTCATTGTCTTGGTGATTGTCCTCAGCCTGCAGCCTTGGAAGAAAAATAACAGTAGTTCACCCGCAACACCCTAA 924 46.97 MNDLFSSRSFSRDTHVVEMGNNASSSPTAVNLDKFFEDVESVKDELKELERLYSSLHDSHEQSKTLHNAKAVKDLRSRMDSDVSLALKKAKLIKVRLEALDRSNAANRSLPGCGPGSSSDRTRTSVVNGLRKKLQDSMESFNNLRQQISSEYRETVQRRYYTVTGENPDEKTIDVLISTGESETFLQKAIQEQGRGRILDTISEIQERHDAVKDLERNLKELHQVFMDMAVLVHEQGEKLDDIESQVNRAHSFVRGGTQELTTARVYQKNTRKWTIIAIIIVLLIVLVIVLSLQPWKKNNSSSPATP 307
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
4 5745094 5747511 + PI0008500.1 Cmetu04g2079 354523

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cmetu04g2079 307 Coils Coil 32 59 - -
Cmetu04g2079 307 SMART SynN_4 27 153 IPR006011 GO:0016020
Cmetu04g2079 307 Coils Coil 127 151 - -
Cmetu04g2079 307 CDD SynN 32 189 IPR006011 GO:0016020
Cmetu04g2079 307 Gene3D - 30 162 - -
Cmetu04g2079 307 PANTHER SYNTAXIN 48 283 IPR045242 -
Cmetu04g2079 307 FunFam Syntaxin 132 195 294 - -
Cmetu04g2079 307 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 202 264 IPR000727 -
Cmetu04g2079 307 CDD SNARE_syntaxin1-like 201 263 - -
Cmetu04g2079 307 Gene3D - 198 294 - -
Cmetu04g2079 307 Pfam SNARE domain 238 290 IPR000727 -
Cmetu04g2079 307 ProSitePatterns Syntaxin / epimorphin family signature. 208 247 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cmetu04g2079 307 SUPERFAMILY t-snare proteins 31 257 IPR010989 GO:0016020|GO:0016192
Cmetu04g2079 307 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 29 159 - -
Cmetu04g2079 307 SMART tSNARE_6 197 264 IPR000727 -
Cmetu04g2079 307 Coils Coil 205 225 - -
Cmetu04g2079 307 Pfam Syntaxin 34 237 IPR006011 GO:0016020
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmetu04g2079 K08486 - - csv:101208931 574.704
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmetu04g2079 Cmetu-Chr4:5745094 Cmetu04g2542 Cmetu-Chr4:10007854 9.00E-63 dispersed
Cmetu08g0109 Cmetu-Chr8:13750538 Cmetu04g2079 Cmetu-Chr4:5745094 2.10E-59 transposed
Cmetu08g1065 Cmetu-Chr8:21696904 Cmetu04g2079 Cmetu-Chr4:5745094 4.00E-47 transposed
Cmetu12g0532 Cmetu-Chr12:4675166 Cmetu04g2079 Cmetu-Chr4:5745094 1.80E-73 transposed
Cmetu04g2079 Cmetu-Chr4:5745094 Cmetu08g1428 Cmetu-Chr8:17904672 1.20E-107 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmetu03g1681 . 8 336 SNARE and Associated Proteins AT3G24350 62.8 3.0e-102 369.0
Cmetu08g0109 . 1 309 SNARE and Associated Proteins AT1G08560 69.4 6.4e-101 364.4
Cmetu08g1065 . 1 303 SNARE and Associated Proteins AT2G18260 54.7 1.9e-84 309.7
Cmetu04g2079 . 22 280 SNARE and Associated Proteins AT3G11820 80.7 1.8e-114 409.5
Cmetu08g1428 . 24 283 SNARE and Associated Proteins AT3G11820 71.2 5.0e-101 364.8
Cmetu12g0532 . 1 202 SNARE and Associated Proteins AT3G11820 69.8 3.0e-77 285.8
Cmetu04g2542 . 36 291 SNARE and Associated Proteins AT3G11820 52.1 7.6e-65 244.6
Cmetu04g2079 . 31 280 SNARE and Associated Proteins AT3G52400 68.8 3.3e-90 328.9
Cmetu08g1428 . 1 283 SNARE and Associated Proteins AT3G52400 59.5 1.9e-85 313.2
Cmetu12g0532 . 1 202 SNARE and Associated Proteins AT3G52400 65.3 1.8e-67 253.4
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT4G03330 57.9 1.0e-82 303.9
Cmetu12g0532 . 1 220 SNARE and Associated Proteins AT4G03330 72.3 1.7e-82 303.1
Cmetu08g1428 . 1 299 SNARE and Associated Proteins AT4G03330 52.2 8.3e-77 284.3
Cmetu04g2542 . 48 291 SNARE and Associated Proteins AT4G03330 54.3 1.1e-63 240.7
Cmetu12g0532 . 1 224 SNARE and Associated Proteins AT1G61290 80.4 9.7e-94 340.5
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT1G61290 62.8 1.0e-90 330.5
Cmetu08g1428 . 1 299 SNARE and Associated Proteins AT1G61290 56.2 3.5e-83 305.4
Cmetu04g2542 . 49 291 SNARE and Associated Proteins AT1G61290 50.4 6.0e-59 224.9
Cmetu12g0532 . 1 224 SNARE and Associated Proteins AT1G11250 79.9 3.9e-95 345.1
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT1G11250 62.5 9.0e-92 334.0
Cmetu08g1428 . 1 294 SNARE and Associated Proteins AT1G11250 56.8 2.8e-85 312.4
Cmetu04g2542 . 17 314 SNARE and Associated Proteins AT3G03800 71.1 1.0e-106 383.6
Cmetu11g1082 . 1 270 SNARE and Associated Proteins AT3G03800 57.4 1.2e-80 297.0
Cmetu12g0532 . 1 203 SNARE and Associated Proteins AT3G03800 55.7 1.6e-56 216.9
Cmetu04g2542 . 17 209 SNARE and Associated Proteins AT5G08080 75.5 7.0e-73 270.8
Cmetu11g1082 . 2 169 SNARE and Associated Proteins AT5G08080 63.1 2.9e-50 195.7
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT5G16830 54.7 1.3e-65 246.9
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT5G46860 59.5 3.6e-68 255.4
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT4G17730 54.8 2.0e-63 239.6
Cmetu06g0720 . 61 249 SNARE and Associated Proteins AT1G32270 58.9 9.7e-50 194.5
Cmetu10g1254 . 1 336 SNARE and Associated Proteins AT5G05760 65.6 1.7e-110 396.4
Cmetu03g1681 . 8 336 SNARE and Associated Proteins AT3G24350 62.8 3.0e-102 369.0
Cmetu05g1168 . 1 327 SNARE and Associated Proteins AT5G26980 75.5 7.9e-126 447.2
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT5G26980 66.8 5.5e-103 371.3
Cmetu05g1168 . 1 329 SNARE and Associated Proteins AT4G02195 64.0 5.9e-105 377.9
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT4G02195 67.1 7.7e-105 377.5
Cmetu05g1168 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 4.6e-129 458.0
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT3G05710 64.3 4.9e-99 358.2
Cmetu01g0482 . 1 233 SNARE and Associated Proteins AT1G16240 73.0 1.7e-90 329.3
Cmetu06g0075 . 58 286 SNARE and Associated Proteins AT1G16240 68.6 2.5e-81 298.9
Cmetu01g0482 . 1 233 SNARE and Associated Proteins AT1G79590 73.0 9.7e-90 327.0
Cmetu06g0075 . 58 286 SNARE and Associated Proteins AT1G79590 67.7 8.2e-81 297.4
Cmetu11g2412 . 56 246 SNARE and Associated Proteins AT1G28490 71.7 1.1e-66 250.0
Cmetu04g1845 . 1 264 SNARE and Associated Proteins AT3G09740 78.9 2.4e-112 402.1
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G09740 67.2 2.5e-93 339.0
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G45280 64.9 3.2e-88 322.0
Cmetu04g1845 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 5.4e-88 321.2
Cmetu04g1845 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 3.4e-95 345.1
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G61450 61.4 3.8e-86 315.1
Cmetu03g1342 . 65 308 SNARE and Associated Proteins AT1G51740 73.2 5.7e-92 334.3
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62