Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cmetu08g0109 ATGAATGACTTAATGACCAAATCGTTCACCAGCTATGTGGATCTGAAGAAGGCAGCCATGAAAGATCTCGACCTCGAAGCCGGTCTAGAAATGGCATCATCCGTTACCGGAGACAACGGTGACATGGGTCTGTTTCTGGAAGAGGCAGAGAAGGTGAAAATGGAGATGGGTTCGATTAGAGAGATTTTAGTTAAACTCCAACAAGCTAATGAAGAAACCAAATCTGCTCACAAACCCGAAACCCTCAAATCGCTTCGTAATGCGATCAATGTAGATATTATCACCGTCCTGAAAAAGGCAAGATCGATCCGATCTCAGCTTGAGGAAATGGATCGTGCCAACGCTGCCAAGAAACGTCTGTCCGGCAGCAAAGAAGGCACTGCCATTTACAGGACAAGAATTGCAGTGACGAACGGGCTTCGAAAGAAGCTAAAGGAATTAATGATGGAGTTTCAAAGCTTGAGGCAGAGGATGATGACGGAGTACAAAGAAACGGTTGGGCGCCGATACTTCACAGTGACGGGGGAGCATCCGGAGGAGGAGGTAATAGAGAAGATAATATCGAATGGTGGGGAGGAGTTTTTAGCAAGGGCAATAGAGGAGCATGGGCGAGGGAAGGTGGCGGAGACAGTGGTGGAGATACAGGACCGACACGGGGCAGCAAAGGAGATAGAGAAGAGCTTGTTAGAGCTACACCAAGTGTTTTTGGACATGGCAGTAATGGTTGAAGCACAGGGGGAGAAAATGGATGATATTGAACATCATGTTATGAATGCTTCACAATATGTTAGAGATGGGACTAAGGATTTGAAAACAGCAAAGGATTTGCAAAGGAATAGTAGAAAATGTATGTGTTTTGGGATTTTGCTTTTGCTTGTGATTATTTTGGTTATTGTTATTCCAATTGCTGTTAGTTTTGGAAGTTCTTGA 930 44.62 MNDLMTKSFTSYVDLKKAAMKDLDLEAGLEMASSVTGDNGDMGLFLEEAEKVKMEMGSIREILVKLQQANEETKSAHKPETLKSLRNAINVDIITVLKKARSIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEHPEEEVIEKIISNGGEEFLARAIEEHGRGKVAETVVEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDDIEHHVMNASQYVRDGTKDLKTAKDLQRNSRKCMCFGILLLLVIILVIVIPIAVSFGSS 309
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
8 13750538 13751938 - PI0024204.1 Cmetu08g0109 362920

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cmetu08g0109 309 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 39 169 - -
Cmetu08g0109 309 Coils Coil 137 157 - -
Cmetu08g0109 309 PANTHER SYNTAXIN 54 297 IPR045242 -
Cmetu08g0109 309 CDD SynN 42 198 IPR006011 GO:0016020
Cmetu08g0109 309 SUPERFAMILY t-snare proteins 41 266 IPR010989 GO:0016020|GO:0016192
Cmetu08g0109 309 CDD SNARE_syntaxin1-like 210 272 - -
Cmetu08g0109 309 SMART tSNARE_6 206 273 IPR000727 -
Cmetu08g0109 309 SMART SynN_4 37 163 IPR006011 GO:0016020
Cmetu08g0109 309 Pfam SNARE domain 248 299 IPR000727 -
Cmetu08g0109 309 FunFam Syntaxin 132 204 304 - -
Cmetu08g0109 309 Pfam Syntaxin 45 246 IPR006011 GO:0016020
Cmetu08g0109 309 Gene3D - 206 307 - -
Cmetu08g0109 309 ProSitePatterns Syntaxin / epimorphin family signature. 217 257 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cmetu08g0109 309 Gene3D - 37 166 - -
Cmetu08g0109 309 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 211 273 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmetu08g0109 K08486 - - csv:101220775 568.926
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmetu08g0109 Cmetu-Chr8:13750538 Cmetu08g1428 Cmetu-Chr8:17904672 1.10E-57 dispersed
Cmetu08g0109 Cmetu-Chr8:13750538 Cmetu04g2079 Cmetu-Chr4:5745094 2.10E-59 transposed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g156 . . . . . . . . . . Cma03g00248 . Car03g00212 . Sed14g0695 Cpe10g01038 Cpe08g00962 Bhi03g02299 Tan03g0640 Cmetu08g0109 . Hepe04g0635 . . . . . . . . . Cone3ag0557 Cone10ag0552 Cone13ag0475 . Lsi01g01659 Csa04g01137 . Cme04g01796 . . . . . . . . . Cmo03g00262 Cmo07g01220 . . . . . . Bhi11g01551 . . . . . . . . . . . . . . . . Cme08g02007
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmetu03g1681 . 8 336 SNARE and Associated Proteins AT3G24350 62.8 3.0e-102 369.0
Cmetu08g0109 . 1 309 SNARE and Associated Proteins AT1G08560 69.4 6.4e-101 364.4
Cmetu08g1065 . 1 303 SNARE and Associated Proteins AT2G18260 54.7 1.9e-84 309.7
Cmetu04g2079 . 22 280 SNARE and Associated Proteins AT3G11820 80.7 1.8e-114 409.5
Cmetu08g1428 . 24 283 SNARE and Associated Proteins AT3G11820 71.2 5.0e-101 364.8
Cmetu12g0532 . 1 202 SNARE and Associated Proteins AT3G11820 69.8 3.0e-77 285.8
Cmetu04g2542 . 36 291 SNARE and Associated Proteins AT3G11820 52.1 7.6e-65 244.6
Cmetu04g2079 . 31 280 SNARE and Associated Proteins AT3G52400 68.8 3.3e-90 328.9
Cmetu08g1428 . 1 283 SNARE and Associated Proteins AT3G52400 59.5 1.9e-85 313.2
Cmetu12g0532 . 1 202 SNARE and Associated Proteins AT3G52400 65.3 1.8e-67 253.4
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT4G03330 57.9 1.0e-82 303.9
Cmetu12g0532 . 1 220 SNARE and Associated Proteins AT4G03330 72.3 1.7e-82 303.1
Cmetu08g1428 . 1 299 SNARE and Associated Proteins AT4G03330 52.2 8.3e-77 284.3
Cmetu04g2542 . 48 291 SNARE and Associated Proteins AT4G03330 54.3 1.1e-63 240.7
Cmetu12g0532 . 1 224 SNARE and Associated Proteins AT1G61290 80.4 9.7e-94 340.5
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT1G61290 62.8 1.0e-90 330.5
Cmetu08g1428 . 1 299 SNARE and Associated Proteins AT1G61290 56.2 3.5e-83 305.4
Cmetu04g2542 . 49 291 SNARE and Associated Proteins AT1G61290 50.4 6.0e-59 224.9
Cmetu12g0532 . 1 224 SNARE and Associated Proteins AT1G11250 79.9 3.9e-95 345.1
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT1G11250 62.5 9.0e-92 334.0
Cmetu08g1428 . 1 294 SNARE and Associated Proteins AT1G11250 56.8 2.8e-85 312.4
Cmetu04g2542 . 17 314 SNARE and Associated Proteins AT3G03800 71.1 1.0e-106 383.6
Cmetu11g1082 . 1 270 SNARE and Associated Proteins AT3G03800 57.4 1.2e-80 297.0
Cmetu12g0532 . 1 203 SNARE and Associated Proteins AT3G03800 55.7 1.6e-56 216.9
Cmetu04g2542 . 17 209 SNARE and Associated Proteins AT5G08080 75.5 7.0e-73 270.8
Cmetu11g1082 . 2 169 SNARE and Associated Proteins AT5G08080 63.1 2.9e-50 195.7
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT5G16830 54.7 1.3e-65 246.9
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT5G46860 59.5 3.6e-68 255.4
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT4G17730 54.8 2.0e-63 239.6
Cmetu06g0720 . 61 249 SNARE and Associated Proteins AT1G32270 58.9 9.7e-50 194.5
Cmetu10g1254 . 1 336 SNARE and Associated Proteins AT5G05760 65.6 1.7e-110 396.4
Cmetu03g1681 . 8 336 SNARE and Associated Proteins AT3G24350 62.8 3.0e-102 369.0
Cmetu05g1168 . 1 327 SNARE and Associated Proteins AT5G26980 75.5 7.9e-126 447.2
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT5G26980 66.8 5.5e-103 371.3
Cmetu05g1168 . 1 329 SNARE and Associated Proteins AT4G02195 64.0 5.9e-105 377.9
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT4G02195 67.1 7.7e-105 377.5
Cmetu05g1168 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 4.6e-129 458.0
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT3G05710 64.3 4.9e-99 358.2
Cmetu01g0482 . 1 233 SNARE and Associated Proteins AT1G16240 73.0 1.7e-90 329.3
Cmetu06g0075 . 58 286 SNARE and Associated Proteins AT1G16240 68.6 2.5e-81 298.9
Cmetu01g0482 . 1 233 SNARE and Associated Proteins AT1G79590 73.0 9.7e-90 327.0
Cmetu06g0075 . 58 286 SNARE and Associated Proteins AT1G79590 67.7 8.2e-81 297.4
Cmetu11g2412 . 56 246 SNARE and Associated Proteins AT1G28490 71.7 1.1e-66 250.0
Cmetu04g1845 . 1 264 SNARE and Associated Proteins AT3G09740 78.9 2.4e-112 402.1
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G09740 67.2 2.5e-93 339.0
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G45280 64.9 3.2e-88 322.0
Cmetu04g1845 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 5.4e-88 321.2
Cmetu04g1845 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 3.4e-95 345.1
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G61450 61.4 3.8e-86 315.1
Cmetu03g1342 . 65 308 SNARE and Associated Proteins AT1G51740 73.2 5.7e-92 334.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32