Cucurbitales platform

Gene search

Sequence information

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Cmetu08g1077	ATGGCCACAAGCGTCTCCCACTCTCCCGATTTCCGCCCTGAAGTTTCCTTTACGCCGCCGACCCACGACGGCCTTTACTTCTGGCAGTTCATGATCGCCGGCTCAATCGCAGGGTCGGTCGAGCACATGGCGATGTATCCAGTGGACACTCTCAAGACCCGAATACAAGCCCTAGGTGGTGGATCGTCAACAGTCCGACAAGCCCTCGGCTCGATTCTGAAAGTGGAAGGTCCGGCTGGGCTCTACCGTGGAATCGGAGCAATGGGTTTAGGCGCAGGACCTGCACACGCCGTCTACTTCTCAGTATACGAATTTGCGAAAGAAGGGTTTTCAATGGGGAATAAGAACAATCCATTAGCGCATGCCATTGCTGGAGTTTGTGCGACGGTGACGAGCGACGCCGTGATAACGCCGATGGATGTAGTGAAACAGAGGCTGCAGTTGAAGAGTAGTCCTTATAAAGGAGTAGGGGACTGTGTGAGGAGGATTTTGGTTGAGGAAGGGATTGGGGCGTTGTATGCTTCTTATCGGACAACGGTTGTGATGAATGCGCCGTATACGGCGGTGTATTTTGCGACTTATGAAGCTGCTAAAAGGGGATTGAAGGAGGTGTCACCGGGAAGTGATGACGATGAGAGGCTGATTGTTCATGCTACGGCCGGTGCGGCAGCTGGGTCTCTTGCTGCTGCTCTTACAACGCCATTAGACGTTGTGAAAACTCGGCTGCAGTGTCAGGGAGTATGTGGTTGCGACAAATTTTCAAGCAGTTCAATTGGGTACGTACTTGGGTGTGTGGTGAAGAAGGATGGCTACAATGGGTTGATGAAAGGATGGATTCCAAGGATGATGTTCCATGCCCCTGCTGCTGCAATTTGCTGGTCCACTTACGAGGCTTCCAAATCCTTCTTTCAACATCTCCACAATCACAACAACAATTAG	939	51.65	MATSVSHSPDFRPEVSFTPPTHDGLYFWQFMIAGSIAGSVEHMAMYPVDTLKTRIQALGGGSSTVRQALGSILKVEGPAGLYRGIGAMGLGAGPAHAVYFSVYEFAKEGFSMGNKNNPLAHAIAGVCATVTSDAVITPMDVVKQRLQLKSSPYKGVGDCVRRILVEEGIGALYASYRTTVVMNAPYTAVYFATYEAAKRGLKEVSPGSDDDERLIVHATAGAAAGSLAAALTTPLDVVKTRLQCQGVCGCDKFSSSSIGYVLGCVVKKDGYNGLMKGWIPRMMFHAPAAAICWSTYEASKSFFQHLHNHNNN	312

Gff information

Chromosome	Start	End	Strand	Old_gene	Gene	Num
8	14855588	14857486	-	PI0028269.1	Cmetu08g1077	363888

Annotation

Seq ID	Length	Analysis	Description	Start	End	IPR	GO
Cmetu08g1077	312	PRINTS	Mitochondrial carrier protein signature	43	57	IPR002067	GO:0055085
Cmetu08g1077	312	PRINTS	Mitochondrial carrier protein signature	221	243	IPR002067	GO:0055085
Cmetu08g1077	312	PRINTS	Mitochondrial carrier protein signature	173	191	IPR002067	GO:0055085
Cmetu08g1077	312	PRINTS	Mitochondrial carrier protein signature	30	43	IPR002067	GO:0055085
Cmetu08g1077	312	PRINTS	Mitochondrial carrier protein signature	131	149	IPR002067	GO:0055085
Cmetu08g1077	312	Gene3D	Mitochondrial carrier domain	150	312	IPR023395	-
Cmetu08g1077	312	PANTHER	MITOFERRIN-1-RELATED	26	305	-	-
Cmetu08g1077	312	Gene3D	Mitochondrial carrier domain	11	149	IPR023395	-
Cmetu08g1077	312	ProSiteProfiles	Solute carrier (Solcar) repeat profile.	212	302	IPR018108	-
Cmetu08g1077	312	Pfam	Mitochondrial carrier protein	213	304	IPR018108	-
Cmetu08g1077	312	Pfam	Mitochondrial carrier protein	116	202	IPR018108	-
Cmetu08g1077	312	Pfam	Mitochondrial carrier protein	26	111	IPR018108	-
Cmetu08g1077	312	FunFam	Mitochondrial RNA-splicing protein MRS3	151	312	-	-
Cmetu08g1077	312	SUPERFAMILY	Mitochondrial carrier	23	297	IPR023395	-
Cmetu08g1077	312	ProSiteProfiles	Solute carrier (Solcar) repeat profile.	116	200	IPR018108	-
Cmetu08g1077	312	ProSiteProfiles	Solute carrier (Solcar) repeat profile.	25	109	IPR018108	-

Pathway

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Cmetu08g1077	K15113	-	-	csv:101210464	610.912

Dupl-types

Select	Gene1	Location1	Gene2	Location2	E-value	Duplicated-type
	Cmetu08g1077	Cmetu-Chr8:14855588	Cmetu11g0163	Cmetu-Chr11:7510231	3.00E-122	dispersed
	Cmetu08g1077	Cmetu-Chr8:14855588	Cmetu08g0647	Cmetu-Chr8:15111967	6.40E-16	transposed

Deco-Alignment

Select	Vvi1	Blo1	Blo2	Bda1	Bda2	Bpe1	Bpe2	Bma1	Bma2	Cmo1	Cmo2	Cma1	Cma2	Car1	Car2	Sed1	Cpe1	Cpe2	Bhi1	Tan1	Cmetu1	Lac1	Hepe1	Mch1	Lcy1	Cla1	Cam1	Cec1	Cco1	Clacu1	Cmu1	Cre1	Cone1	Cone2	Cone3	Cone4	Lsi1	Csa1	Chy1	Cme1	Blo3	Blo4	Bda3	Bda4	Bpe3	Bpe4	Bma3	Bma4	Sed2	Cmo3	Cmo4	Cma3	Cma4	Car3	Car4	Cpe3	Cpe4	Bhi2	Tan2	Cmetu2	Lac2	Hepe2	Mch2	Lcy2	Cla2	Cam2	Cec2	Cco2	Clacu2	Cmu2	Cre2	Lsi2	Csa2	Chy2	Cme2
	Vvi8g316	.	.	.	.	.	.	.	.	.	.	Cma03g00330	Cma07g01076	Car03g00292	Car07g01060	Sed03g2513	.	.	Bhi03g02177	Tan03g0759	Cmetu08g1077	.	Hepe04g0728	.	.	Cla04g00684	Cam04g0686	Cec04g0807	Cco04g0860	Clacu04g0732	Cmu04g0726	Cre04g0775	.	.	.	.	Lsi01g01574	Csa04g01643	Chy08g00612	.	.	.	.	.	.	.	.	.	.	Cmo03g00342	Cmo07g01125	.	.	.	.	.	Cpe19g00268	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	Cme08g02177

Syn-Families

Gene	Event_type	S_start	S_end	Function	Ath_gene	Identity(%)	E-value	Score
Cmetu12g1488	.	1	388	Chloroplast and Mitochondria Gene Families	AT2G28800	65.9	6.6e-136	481.1
Cmetu03g0657	.	71	425	Chloroplast and Mitochondria Gene Families	AT2G28800	55.4	6.4e-99	358.2
Cmetu03g1826	.	3	209	Chloroplast and Mitochondria Gene Families	AT1G15820	78.5	3.2e-93	338.6
Cmetu01g1261	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	89.5	1.3e-143	506.1
Cmetu11g2118	.	2	267	Chloroplast and Mitochondria Gene Families	AT3G27690	78.4	7.0e-121	430.6
Cmetu04g1559	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	77.0	9.2e-121	430.3
Cmetu04g0833	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	77.0	9.2e-121	430.3
Cmetu12g0190	.	3	267	Chloroplast and Mitochondria Gene Families	AT3G27690	78.1	6.0e-120	427.6
Cmetu12g1325	.	2	265	Chloroplast and Mitochondria Gene Families	AT3G27690	77.0	2.3e-119	425.6
Cmetu04g0179	.	1	265	Chloroplast and Mitochondria Gene Families	AT3G27690	76.9	5.6e-118	421.0
Cmetu06g0565	.	5	264	Chloroplast and Mitochondria Gene Families	AT3G27690	67.4	1.3e-98	356.7
Cmetu07g0171	.	120	336	Chloroplast and Mitochondria Gene Families	AT3G27690	50.7	6.3e-53	204.9
Cmetu09g0513	.	69	272	Chloroplast and Mitochondria Gene Families	AT3G27690	52.6	1.2e-51	200.7
Cmetu02g0801	.	42	250	Chloroplast and Mitochondria Gene Families	AT3G61470	64.1	1.2e-84	310.1
Cmetu10g0959	.	36	214	Chloroplast and Mitochondria Gene Families	AT3G61470	70.2	7.0e-69	257.7
Cmetu02g0368	.	22	249	Chloroplast and Mitochondria Gene Families	AT3G61470	51.3	8.9e-64	240.7
Cmetu09g0209	.	1	198	Chloroplast and Mitochondria Gene Families	AT3G54890	82.1	2.7e-90	328.6
Cmetu08g1554	.	3	284	Chloroplast and Mitochondria Gene Families	AT3G08940	83.4	1.3e-135	479.6
Cmetu07g0171	.	55	343	Chloroplast and Mitochondria Gene Families	AT1G76570	79.9	7.2e-143	503.8
Cmetu02g2047	.	1	273	Chloroplast and Mitochondria Gene Families	AT1G61520	86.4	1.9e-136	482.3
Cmetu01g1261	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G05070	89.4	2.0e-143	505.4
Cmetu04g1559	.	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.6	3.1e-120	428.3
Cmetu04g0833	.	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.6	3.1e-120	428.3
Cmetu11g2118	.	7	267	Chloroplast and Mitochondria Gene Families	AT2G05070	78.9	6.9e-120	427.2
Cmetu12g0190	.	6	267	Chloroplast and Mitochondria Gene Families	AT2G05070	78.6	1.5e-119	426.0
Cmetu12g1325	.	5	265	Chloroplast and Mitochondria Gene Families	AT2G05070	78.2	2.6e-119	425.2
Cmetu04g0179	.	27	265	Chloroplast and Mitochondria Gene Families	AT2G05070	83.7	1.9e-117	419.1
Cmetu06g0565	.	8	264	Chloroplast and Mitochondria Gene Families	AT2G05070	68.8	6.7e-99	357.5
Cmetu01g1261	.	1	237	Chloroplast and Mitochondria Gene Families	AT2G05100	89.5	1.1e-124	443.4
Cmetu12g0190	.	6	239	Chloroplast and Mitochondria Gene Families	AT2G05100	76.9	7.8e-102	367.5
Cmetu04g1559	.	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	75.9	2.3e-101	365.9
Cmetu04g0833	.	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	75.9	2.3e-101	365.9
Cmetu12g1325	.	5	237	Chloroplast and Mitochondria Gene Families	AT2G05100	76.9	5.0e-101	364.8
Cmetu11g2118	.	7	239	Chloroplast and Mitochondria Gene Families	AT2G05100	77.4	5.0e-101	364.8
Cmetu04g0179	.	8	237	Chloroplast and Mitochondria Gene Families	AT2G05100	77.6	1.6e-99	359.8
Cmetu06g0565	.	8	236	Chloroplast and Mitochondria Gene Families	AT2G05100	68.1	1.6e-83	306.6
Cmetu09g0513	.	69	256	Chloroplast and Mitochondria Gene Families	AT2G05100	51.8	2.8e-43	172.9
Cmetu08g1554	.	3	167	Chloroplast and Mitochondria Gene Families	AT2G40100	72.8	8.1e-67	250.4
Cmetu11g2118	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29930	88.8	6.3e-137	483.8
Cmetu04g1559	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	88.8	1.5e-135	479.2
Cmetu04g0833	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	88.8	1.5e-135	479.2
Cmetu12g1325	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29930	86.9	1.3e-134	476.1
Cmetu12g0190	.	3	267	Chloroplast and Mitochondria Gene Families	AT1G29930	87.3	1.9e-133	472.2
Cmetu04g0179	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29930	84.5	5.0e-126	447.6
Cmetu01g1261	.	3	265	Chloroplast and Mitochondria Gene Families	AT1G29930	78.7	2.1e-116	415.6
Cmetu06g0565	.	11	264	Chloroplast and Mitochondria Gene Families	AT1G29930	67.8	1.0e-94	343.6
Cmetu09g0513	.	52	272	Chloroplast and Mitochondria Gene Families	AT1G29930	50.7	3.3e-53	205.7
Cmetu11g2118	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29920	88.4	2.4e-136	481.9
Cmetu04g1559	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	88.4	5.9e-135	477.2
Cmetu04g0833	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	88.4	5.9e-135	477.2
Cmetu12g1325	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29920	86.5	5.0e-134	474.2
Cmetu12g0190	.	3	267	Chloroplast and Mitochondria Gene Families	AT1G29920	86.9	7.2e-133	470.3
Cmetu04g0179	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29920	84.5	6.5e-126	447.2
Cmetu01g1261	.	3	265	Chloroplast and Mitochondria Gene Families	AT1G29920	78.3	1.6e-116	416.0
Cmetu06g0565	.	34	264	Chloroplast and Mitochondria Gene Families	AT1G29920	70.2	1.0e-94	343.6
Cmetu09g0513	.	52	272	Chloroplast and Mitochondria Gene Families	AT1G29920	50.7	3.3e-53	205.7
Cmetu11g2118	.	1	267	Chloroplast and Mitochondria Gene Families	AT1G29910	88.4	2.4e-136	481.9
Cmetu04g1559	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	88.4	5.9e-135	477.2
Cmetu04g0833	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	88.4	5.9e-135	477.2
Cmetu12g1325	.	1	265	Chloroplast and Mitochondria Gene Families	AT1G29910	86.5	5.0e-134	474.2
Cmetu12g0190	.	3	267	Chloroplast and Mitochondria Gene Families	AT1G29910	86.9	7.2e-133	470.3
Cmetu04g0179	.	4	265	Chloroplast and Mitochondria Gene Families	AT1G29910	84.5	6.5e-126	447.2
Cmetu01g1261	.	3	265	Chloroplast and Mitochondria Gene Families	AT1G29910	78.3	1.6e-116	416.0
Cmetu06g0565	.	34	264	Chloroplast and Mitochondria Gene Families	AT1G29910	70.2	1.0e-94	343.6
Cmetu09g0513	.	52	272	Chloroplast and Mitochondria Gene Families	AT1G29910	50.7	3.3e-53	205.7
Cmetu09g0513	.	11	287	Chloroplast and Mitochondria Gene Families	AT4G10340	85.1	2.3e-137	485.3
Cmetu12g1325	.	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.0	2.3e-57	219.5
Cmetu04g1559	.	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.0	6.7e-57	218.0
Cmetu04g0833	.	37	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.0	6.7e-57	218.0
Cmetu12g0190	.	39	255	Chloroplast and Mitochondria Gene Families	AT4G10340	52.0	6.7e-57	218.0
Cmetu04g0179	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	8.8e-57	217.6
Cmetu11g2118	.	51	255	Chloroplast and Mitochondria Gene Families	AT4G10340	54.1	1.1e-56	217.2
Cmetu01g1261	.	49	253	Chloroplast and Mitochondria Gene Families	AT4G10340	52.6	3.1e-54	209.1
Cmetu06g0565	.	46	252	Chloroplast and Mitochondria Gene Families	AT4G10340	54.0	2.2e-52	203.0
Cmetu11g2118	.	1	267	Chloroplast and Mitochondria Gene Families	AT2G34420	88.8	4.0e-136	481.1
Cmetu04g1559	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	88.0	6.5e-134	473.8
Cmetu04g0833	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	88.0	6.5e-134	473.8
Cmetu12g1325	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34420	86.5	2.5e-133	471.9
Cmetu12g0190	.	3	267	Chloroplast and Mitochondria Gene Families	AT2G34420	86.9	3.5e-132	468.0
Cmetu04g0179	.	4	265	Chloroplast and Mitochondria Gene Families	AT2G34420	84.9	1.0e-126	449.9
Cmetu01g1261	.	3	265	Chloroplast and Mitochondria Gene Families	AT2G34420	77.5	5.5e-117	417.5
Cmetu06g0565	.	34	264	Chloroplast and Mitochondria Gene Families	AT2G34420	70.7	1.0e-94	343.6
Cmetu12g1325	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	87.6	2.8e-137	485.0
Cmetu04g1559	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	88.7	8.2e-137	483.4
Cmetu04g0833	.	1	265	Chloroplast and Mitochondria Gene Families	AT2G34430	88.7	8.2e-137	483.4
Cmetu11g2118	.	1	267	Chloroplast and Mitochondria Gene Families	AT2G34430	88.4	6.9e-136	480.3
Cmetu12g0190	.	3	267	Chloroplast and Mitochondria Gene Families	AT2G34430	87.6	3.4e-135	478.0
Cmetu04g0179	.	4	265	Chloroplast and Mitochondria Gene Families	AT2G34430	85.2	1.4e-128	456.1
Cmetu01g1261	.	31	265	Chloroplast and Mitochondria Gene Families	AT2G34430	83.6	5.2e-115	411.0
Cmetu06g0565	.	34	264	Chloroplast and Mitochondria Gene Families	AT2G34430	71.4	1.0e-94	343.6
Cmetu08g1554	.	2	284	Chloroplast and Mitochondria Gene Families	AT5G01530	84.5	4.3e-139	491.1
Cmetu06g0745	.	48	307	Chloroplast and Mitochondria Gene Families	AT5G40810	93.5	3.3e-143	504.6
Cmetu06g0745	.	1	307	Chloroplast and Mitochondria Gene Families	AT3G27240	85.7	2.6e-150	528.5
Cmetu11g0163	.	5	324	Chloroplast and Mitochondria Gene Families	AT2G30160	75.4	1.2e-142	503.1
Cmetu08g1077	.	9	311	Chloroplast and Mitochondria Gene Families	AT2G30160	65.2	1.3e-112	403.3
Cmetu11g0163	.	5	323	Chloroplast and Mitochondria Gene Families	AT1G07030	75.5	1.8e-141	499.2
Cmetu08g1077	.	5	311	Chloroplast and Mitochondria Gene Families	AT1G07030	68.2	2.5e-119	425.6
Cmetu01g1850	.	1	305	Chloroplast and Mitochondria Gene Families	AT2G47490	76.4	1.1e-135	479.9
Cmetu09g1187	.	11	312	Chloroplast and Mitochondria Gene Families	AT2G47490	64.6	3.7e-112	401.7
Cmetu09g1187	.	10	364	Chloroplast and Mitochondria Gene Families	AT1G25380	64.0	4.9e-124	441.4
Cmetu01g1850	.	11	297	Chloroplast and Mitochondria Gene Families	AT1G25380	64.5	9.2e-107	384.0
Cmetu12g0551	.	6	568	Chloroplast and Mitochondria Gene Families	AT4G21490	71.6	2.2e-243	838.6
Cmetu11g0692	.	1	585	Chloroplast and Mitochondria Gene Families	AT4G21490	69.3	5.9e-241	830.5
Cmetu01g0312	.	1	574	Chloroplast and Mitochondria Gene Families	AT4G21490	64.5	5.9e-225	777.3
Cmetu01g2125	.	5	185	Chloroplast and Mitochondria Gene Families	AT1G17530	65.2	7.8e-62	233.8
Cmetu02g1778	.	4	179	Chloroplast and Mitochondria Gene Families	AT1G17530	58.4	2.1e-51	199.1
Cmetu02g1778	.	12	183	Chloroplast and Mitochondria Gene Families	AT3G04800	59.0	2.8e-51	198.7
Cmetu01g2125	.	22	181	Chloroplast and Mitochondria Gene Families	AT3G04800	55.6	3.9e-40	161.8
Cmetu01g2125	.	15	185	Chloroplast and Mitochondria Gene Families	AT1G72750	68.2	4.4e-60	228.0
Cmetu02g1778	.	10	183	Chloroplast and Mitochondria Gene Families	AT1G72750	59.9	8.8e-53	203.8
Cmetu10g1760	.	1	223	Chloroplast and Mitochondria Gene Families	AT1G26100	62.8	3.7e-72	268.5
Cmetu09g1595	.	1	211	Chloroplast and Mitochondria Gene Families	AT5G38630	66.1	2.5e-81	298.9
Cmetu04g1101	.	23	218	Chloroplast and Mitochondria Gene Families	AT4G25570	73.5	2.1e-82	302.8
Cmetu09g1860	.	5	222	Chloroplast and Mitochondria Gene Families	AT1G14730	51.4	1.3e-63	240.0
Cmetu09g0229	.	9	353	Chloroplast and Mitochondria Gene Families	AT5G14040	82.6	6.0e-170	594.0
Cmetu02g1106	.	26	334	Chloroplast and Mitochondria Gene Families	AT5G14040	84.3	1.1e-152	536.6
Cmetu06g1238	.	10	364	Chloroplast and Mitochondria Gene Families	AT5G14040	73.4	1.1e-152	536.6
Cmetu01g2526	.	11	298	Chloroplast and Mitochondria Gene Families	AT5G14040	52.4	1.7e-84	310.1
Cmetu09g0229	.	8	353	Chloroplast and Mitochondria Gene Families	AT3G48850	71.2	8.0e-143	503.8
Cmetu06g1238	.	8	357	Chloroplast and Mitochondria Gene Families	AT3G48850	69.0	1.5e-141	499.6
Cmetu02g1106	.	27	334	Chloroplast and Mitochondria Gene Families	AT3G48850	75.0	4.5e-138	488.0
Cmetu01g2526	.	11	297	Chloroplast and Mitochondria Gene Families	AT3G48850	50.5	6.4e-84	308.1
Cmetu01g2526	.	14	309	Chloroplast and Mitochondria Gene Families	AT2G17270	76.7	7.0e-132	467.2
Cmetu06g1238	.	64	362	Chloroplast and Mitochondria Gene Families	AT2G17270	51.5	2.0e-86	316.2
Cmetu09g0229	.	63	353	Chloroplast and Mitochondria Gene Families	AT2G17270	52.2	6.5e-85	311.2
Cmetu09g1846	.	16	313	Chloroplast and Mitochondria Gene Families	AT5G15640	77.1	2.6e-129	458.8
Cmetu06g0327	.	17	320	Chloroplast and Mitochondria Gene Families	AT5G15640	50.3	1.9e-79	293.1
Cmetu07g1161	.	12	345	Chloroplast and Mitochondria Gene Families	AT5G26200	68.3	1.4e-125	446.4
Cmetu01g1512	.	1	347	Chloroplast and Mitochondria Gene Families	AT5G26200	57.3	8.1e-105	377.5
Cmetu01g1512	.	1	351	Chloroplast and Mitochondria Gene Families	AT1G72820	74.6	1.9e-146	515.8
Cmetu07g1161	.	1	346	Chloroplast and Mitochondria Gene Families	AT1G72820	68.2	5.7e-130	461.1
Cmetu09g1164	.	78	283	Chloroplast and Mitochondria Gene Families	AT5G52570	51.0	2.8e-48	189.1
Cmetu06g0550	.	67	285	Chloroplast and Mitochondria Gene Families	AT4G25700	63.7	2.8e-69	258.8
Cmetu09g1164	.	65	200	Chloroplast and Mitochondria Gene Families	AT4G25700	70.6	3.1e-52	202.2
Cmetu01g1793	.	137	315	Chloroplast and Mitochondria Gene Families	AT4G03320	52.8	1.2e-56	217.2
Cmetu06g1203	.	72	359	Chloroplast and Mitochondria Gene Families	AT5G54290	80.3	1.3e-121	433.3
Cmetu02g0080	.	35	544	Chloroplast and Mitochondria Gene Families	AT2G18710	83.8	3.0e-242	834.7

Syn-Orthogroups

Select	Orthogroup	Bda	Bhi	Blo	Bma	Bpe	Cam	Car	Cco	Cec	Chy	Cla	Clacu	Cma	Cme	Cmetu	Cmo	Cmu	Cone	Cpe	Cre	Csa	HCH	Hepe	Lac	Lcy	Lsi	Mch	Sed	Tan	Vvi	Total
	OG0001660	3	2	4	3	4	2	3	2	2	2	2	2	4	2	2	4	2	1	4	2	2	2	2	2	2	2	1	2	2	1	70