Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cmetu08g1428 ATGAACGATCTGTTTTCCACCGATTCCTTCCGCCAAGAGCATCAGCATCGCCGCCATGACACCGTCGAGATGTCCGACAACGCACCGTCCTCAACGACGATCAATCTCAACACCTTCTTCGACGACGTGGAGTCGGTCAAGGCGGAATTAACAGAGCTCGAACGGCTCTACCGAAGCCTCCAGAATTCTCACGAACAGAGCAAAACTCTGCACAATTCGAAGGCGATTAAGGATGTTCGATCGCGAATGGAAACGGATGTGACATTGGCTTTGAAGAAGGCTAGGTTTATCAAGGTCCGGTTGGAGGAACTGGACCGGTTGAATGAGGAGAACCGGAAGCTTCCTGGTTGTGGGTATGGATCCTCGGCGGACCGGTCGAGAACATCGGTGGTGAGTGGATTGAGGAAGAAGCTGTGTGATTCAATGGAGAGTTTTAACAAATTGAGAGAAGAGATATCGAAAACGTATAAGGAGACGATTGAACGGAGGTATTTTACAATTACAGGCGAAAATCCGGATGAGAAGACTGTTGATTTGTTGATCTCTACAGGTGAAAGTGAAACGTTCTTGCAAAAAGCAATACAAAAGCAAGGAAGAGGAAGAGTTTTGGAAACAATCCAAGAGATTCAAGAAAGGCACGACGCAGTGAAAGACATAGAGAGGAATTTGAGAGAGTTGCACCAAGTTTTCTTGGACATGGCGGTTTTGGTTCAAGCACAAGGGCAACAATTAGACGACATTGAAAGCCAAGTTACTCGAGCCAACTCCGCTGTCAAGCGCGGCACGACCGAGCTACAAACTGCAAGATACTATCAGAAAAACACTCGCAAATGGATCTGCATAGGCGTTGGTATTCTTGCAGTCATTCTCTTCATCATTATCCTTTCTGTCGTCCTCTCGAAGAAGTAA 909 46.75 MNDLFSTDSFRQEHQHRRHDTVEMSDNAPSSTTINLNTFFDDVESVKAELTELERLYRSLQNSHEQSKTLHNSKAIKDVRSRMETDVTLALKKARFIKVRLEELDRLNEENRKLPGCGYGSSADRSRTSVVSGLRKKLCDSMESFNKLREEISKTYKETIERRYFTITGENPDEKTVDLLISTGESETFLQKAIQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQVFLDMAVLVQAQGQQLDDIESQVTRANSAVKRGTTELQTARYYQKNTRKWICIGVGILAVILFIIILSVVLSKK 302
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
8 17904672 17906249 + PI0028371.1 Cmetu08g1428 364239

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cmetu08g1428 302 Pfam Syntaxin 39 241 IPR006011 GO:0016020
Cmetu08g1428 302 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 206 268 IPR000727 -
Cmetu08g1428 302 SMART tSNARE_6 201 268 IPR000727 -
Cmetu08g1428 302 CDD SynN 39 193 IPR006011 GO:0016020
Cmetu08g1428 302 MobiDBLite consensus disorder prediction 1 29 - -
Cmetu08g1428 302 Coils Coil 43 70 - -
Cmetu08g1428 302 ProSitePatterns Syntaxin / epimorphin family signature. 212 251 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cmetu08g1428 302 CDD SNARE_syntaxin1-like 205 267 - -
Cmetu08g1428 302 PANTHER SYNTAXIN 52 292 IPR045242 -
Cmetu08g1428 302 Gene3D - 201 300 - -
Cmetu08g1428 302 SUPERFAMILY t-snare proteins 35 261 IPR010989 GO:0016020|GO:0016192
Cmetu08g1428 302 MobiDBLite consensus disorder prediction 9 24 - -
Cmetu08g1428 302 SMART SynN_4 31 157 IPR006011 GO:0016020
Cmetu08g1428 302 Gene3D - 34 166 - -
Cmetu08g1428 302 FunFam Syntaxin 132 199 299 - -
Cmetu08g1428 302 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 33 163 - -
Cmetu08g1428 302 Pfam SNARE domain 243 294 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmetu08g1428 K08486 - - csv:101213443 526.168
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmetu08g0109 Cmetu-Chr8:13750538 Cmetu08g1428 Cmetu-Chr8:17904672 1.10E-57 dispersed
Cmetu08g1065 Cmetu-Chr8:21696904 Cmetu08g1428 Cmetu-Chr8:17904672 2.30E-42 dispersed
Cmetu08g1428 Cmetu-Chr8:17904672 Cmetu12g0532 Cmetu-Chr12:4675166 1.10E-68 dispersed
Cmetu04g2542 Cmetu-Chr4:10007854 Cmetu08g1428 Cmetu-Chr8:17904672 5.40E-63 transposed
Cmetu04g2079 Cmetu-Chr4:5745094 Cmetu08g1428 Cmetu-Chr8:17904672 1.20E-107 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmetu03g1681 . 8 336 SNARE and Associated Proteins AT3G24350 62.8 3.0e-102 369.0
Cmetu08g0109 . 1 309 SNARE and Associated Proteins AT1G08560 69.4 6.4e-101 364.4
Cmetu08g1065 . 1 303 SNARE and Associated Proteins AT2G18260 54.7 1.9e-84 309.7
Cmetu04g2079 . 22 280 SNARE and Associated Proteins AT3G11820 80.7 1.8e-114 409.5
Cmetu08g1428 . 24 283 SNARE and Associated Proteins AT3G11820 71.2 5.0e-101 364.8
Cmetu12g0532 . 1 202 SNARE and Associated Proteins AT3G11820 69.8 3.0e-77 285.8
Cmetu04g2542 . 36 291 SNARE and Associated Proteins AT3G11820 52.1 7.6e-65 244.6
Cmetu04g2079 . 31 280 SNARE and Associated Proteins AT3G52400 68.8 3.3e-90 328.9
Cmetu08g1428 . 1 283 SNARE and Associated Proteins AT3G52400 59.5 1.9e-85 313.2
Cmetu12g0532 . 1 202 SNARE and Associated Proteins AT3G52400 65.3 1.8e-67 253.4
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT4G03330 57.9 1.0e-82 303.9
Cmetu12g0532 . 1 220 SNARE and Associated Proteins AT4G03330 72.3 1.7e-82 303.1
Cmetu08g1428 . 1 299 SNARE and Associated Proteins AT4G03330 52.2 8.3e-77 284.3
Cmetu04g2542 . 48 291 SNARE and Associated Proteins AT4G03330 54.3 1.1e-63 240.7
Cmetu12g0532 . 1 224 SNARE and Associated Proteins AT1G61290 80.4 9.7e-94 340.5
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT1G61290 62.8 1.0e-90 330.5
Cmetu08g1428 . 1 299 SNARE and Associated Proteins AT1G61290 56.2 3.5e-83 305.4
Cmetu04g2542 . 49 291 SNARE and Associated Proteins AT1G61290 50.4 6.0e-59 224.9
Cmetu12g0532 . 1 224 SNARE and Associated Proteins AT1G11250 79.9 3.9e-95 345.1
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT1G11250 62.5 9.0e-92 334.0
Cmetu08g1428 . 1 294 SNARE and Associated Proteins AT1G11250 56.8 2.8e-85 312.4
Cmetu04g2542 . 17 314 SNARE and Associated Proteins AT3G03800 71.1 1.0e-106 383.6
Cmetu11g1082 . 1 270 SNARE and Associated Proteins AT3G03800 57.4 1.2e-80 297.0
Cmetu12g0532 . 1 203 SNARE and Associated Proteins AT3G03800 55.7 1.6e-56 216.9
Cmetu04g2542 . 17 209 SNARE and Associated Proteins AT5G08080 75.5 7.0e-73 270.8
Cmetu11g1082 . 2 169 SNARE and Associated Proteins AT5G08080 63.1 2.9e-50 195.7
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT5G16830 54.7 1.3e-65 246.9
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT5G46860 59.5 3.6e-68 255.4
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT4G17730 54.8 2.0e-63 239.6
Cmetu06g0720 . 61 249 SNARE and Associated Proteins AT1G32270 58.9 9.7e-50 194.5
Cmetu10g1254 . 1 336 SNARE and Associated Proteins AT5G05760 65.6 1.7e-110 396.4
Cmetu03g1681 . 8 336 SNARE and Associated Proteins AT3G24350 62.8 3.0e-102 369.0
Cmetu05g1168 . 1 327 SNARE and Associated Proteins AT5G26980 75.5 7.9e-126 447.2
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT5G26980 66.8 5.5e-103 371.3
Cmetu05g1168 . 1 329 SNARE and Associated Proteins AT4G02195 64.0 5.9e-105 377.9
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT4G02195 67.1 7.7e-105 377.5
Cmetu05g1168 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 4.6e-129 458.0
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT3G05710 64.3 4.9e-99 358.2
Cmetu01g0482 . 1 233 SNARE and Associated Proteins AT1G16240 73.0 1.7e-90 329.3
Cmetu06g0075 . 58 286 SNARE and Associated Proteins AT1G16240 68.6 2.5e-81 298.9
Cmetu01g0482 . 1 233 SNARE and Associated Proteins AT1G79590 73.0 9.7e-90 327.0
Cmetu06g0075 . 58 286 SNARE and Associated Proteins AT1G79590 67.7 8.2e-81 297.4
Cmetu11g2412 . 56 246 SNARE and Associated Proteins AT1G28490 71.7 1.1e-66 250.0
Cmetu04g1845 . 1 264 SNARE and Associated Proteins AT3G09740 78.9 2.4e-112 402.1
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G09740 67.2 2.5e-93 339.0
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G45280 64.9 3.2e-88 322.0
Cmetu04g1845 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 5.4e-88 321.2
Cmetu04g1845 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 3.4e-95 345.1
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G61450 61.4 3.8e-86 315.1
Cmetu03g1342 . 65 308 SNARE and Associated Proteins AT1G51740 73.2 5.7e-92 334.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62