Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cmetu11g0284 ATGACTGTAATCGACATCATCTTCCGAGTCGATTCCATTTGCAAGAAATACGAAAAGTATGATGTCGAGAAACAGCGTGAGCTCAATGCTTATGGTGATGATGCCTTCGCTCGCCTCTTCGCCGCCGTCGAACTCGAAATCCACGCCGCTCTCCAGAAATCTGAGGTTGCTTCAACTGAGACGAATAGGGCTGCTGCTGTTGCGATGAACGCTGAGGTTCGACGGAAGAAGGCTCGATTGATGGATGAAGTCCCTAAGCTTCGTAAATTGGCTCACAAGAAGGTAAAAGGGGTTCCAAAAGAAGAGCTGGAGGTGAGAGATGATCTTGTTCTTGCACTTGAAGAGAAGATTAAAGCCATACCAGATGGGAGTACCTCAGGAGCCAAACATTCTGGAGGATGGGGCTCCTCCTCCTCATCTAACAATATCAAGTTTGATTCATCATCAGATGGAAACTTCGAGAGCGAGTACTTCCAGCAAAGTGAAGAATCAAGTCAATTTCGAAATGAGTATGAAATGCGGAAGATGAAACAGGACCAAGGTCTCGATGTCATATCCGAAGGTTTGGACATGCTGAAAAATCTGGCTCATGATATGAATGAGGAATTGGATAGGCAAGTTCCATTAATCGACGAGATCGACTCAAAGGTGGACAAAGTGACTGATGAGATTAAAAATACCAATGTTAGGCTCAAGGAAACACTCTATGAGGTGAGAAGTAGCCAAAACTTCTGCATTGATATCGTTCTTCTCTGTGTAATTCTTGGAATTGCTTCTTACTTGTACAAGTACGTAATTTTAAAAAAATGTATGTTGTATGGTGTATCTAACTTCCTTGGATTCACATTGACATGA 855 42.92 MTVIDIIFRVDSICKKYEKYDVEKQRELNAYGDDAFARLFAAVELEIHAALQKSEVASTETNRAAAVAMNAEVRRKKARLMDEVPKLRKLAHKKVKGVPKEELEVRDDLVLALEEKIKAIPDGSTSGAKHSGGWGSSSSSNNIKFDSSSDGNFESEYFQQSEESSQFRNEYEMRKMKQDQGLDVISEGLDMLKNLAHDMNEELDRQVPLIDEIDSKVDKVTDEIKNTNVRLKETLYEVRSSQNFCIDIVLLCVILGIASYLYKYVILKKCMLYGVSNFLGFTLT 284
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
11 5864568 5868646 - PI0022128.1 Cmetu11g0284 369016

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cmetu11g0284 284 PANTHER SYNTAXIN 49 254 IPR045242 -
Cmetu11g0284 284 Gene3D - 172 233 - -
Cmetu11g0284 284 MobiDBLite consensus disorder prediction 129 146 - -
Cmetu11g0284 284 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 172 234 IPR000727 -
Cmetu11g0284 284 FunFam Putative syntaxin-71-like 172 233 - -
Cmetu11g0284 284 Coils Coil 210 230 - -
Cmetu11g0284 284 SUPERFAMILY SNARE fusion complex 168 232 - -
Cmetu11g0284 284 Pfam SNARE domain 209 258 IPR000727 -
Cmetu11g0284 284 ProSitePatterns Syntaxin / epimorphin family signature. 178 217 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cmetu11g0284 284 MobiDBLite consensus disorder prediction 121 146 - -
Cmetu11g0284 284 CDD SNARE_Qc 177 233 - -
Cmetu11g0284 284 SMART tSNARE_6 167 234 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmetu11g0284 K08506 - - csv:101211289 461.07
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmetu11g0284 Cmetu-Chr11:5864568 Cmetu04g1845 Cmetu-Chr4:4140249 2.20E-95 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi6g289 . . Bda02g00767 . Bpe01g00179 . . . . . . . . . . Cpe05g00828 . . . . . . . . Cla02g02052 Cam02g2177 Cec02g2216 Cco02g2256 Clacu02g2162 Cmu02g2099 Cre02g2412 . Cone5ag1222 . . . . . Cme11g01789 . Blo14g00167 . . . . . Bma11g00164 Sed05g2859 Cmo02g00885 Cmo20g00513 Cma02g00885 . . Car20g00420 . . Bhi10g00561 Tan05g0265 Cmetu11g0284 . Hepe08g0878 . . . . . . . . . . . . .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmetu03g1681 . 8 336 SNARE and Associated Proteins AT3G24350 62.8 3.0e-102 369.0
Cmetu08g0109 . 1 309 SNARE and Associated Proteins AT1G08560 69.4 6.4e-101 364.4
Cmetu08g1065 . 1 303 SNARE and Associated Proteins AT2G18260 54.7 1.9e-84 309.7
Cmetu04g2079 . 22 280 SNARE and Associated Proteins AT3G11820 80.7 1.8e-114 409.5
Cmetu08g1428 . 24 283 SNARE and Associated Proteins AT3G11820 71.2 5.0e-101 364.8
Cmetu12g0532 . 1 202 SNARE and Associated Proteins AT3G11820 69.8 3.0e-77 285.8
Cmetu04g2542 . 36 291 SNARE and Associated Proteins AT3G11820 52.1 7.6e-65 244.6
Cmetu04g2079 . 31 280 SNARE and Associated Proteins AT3G52400 68.8 3.3e-90 328.9
Cmetu08g1428 . 1 283 SNARE and Associated Proteins AT3G52400 59.5 1.9e-85 313.2
Cmetu12g0532 . 1 202 SNARE and Associated Proteins AT3G52400 65.3 1.8e-67 253.4
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT4G03330 57.9 1.0e-82 303.9
Cmetu12g0532 . 1 220 SNARE and Associated Proteins AT4G03330 72.3 1.7e-82 303.1
Cmetu08g1428 . 1 299 SNARE and Associated Proteins AT4G03330 52.2 8.3e-77 284.3
Cmetu04g2542 . 48 291 SNARE and Associated Proteins AT4G03330 54.3 1.1e-63 240.7
Cmetu12g0532 . 1 224 SNARE and Associated Proteins AT1G61290 80.4 9.7e-94 340.5
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT1G61290 62.8 1.0e-90 330.5
Cmetu08g1428 . 1 299 SNARE and Associated Proteins AT1G61290 56.2 3.5e-83 305.4
Cmetu04g2542 . 49 291 SNARE and Associated Proteins AT1G61290 50.4 6.0e-59 224.9
Cmetu12g0532 . 1 224 SNARE and Associated Proteins AT1G11250 79.9 3.9e-95 345.1
Cmetu04g2079 . 1 280 SNARE and Associated Proteins AT1G11250 62.5 9.0e-92 334.0
Cmetu08g1428 . 1 294 SNARE and Associated Proteins AT1G11250 56.8 2.8e-85 312.4
Cmetu04g2542 . 17 314 SNARE and Associated Proteins AT3G03800 71.1 1.0e-106 383.6
Cmetu11g1082 . 1 270 SNARE and Associated Proteins AT3G03800 57.4 1.2e-80 297.0
Cmetu12g0532 . 1 203 SNARE and Associated Proteins AT3G03800 55.7 1.6e-56 216.9
Cmetu04g2542 . 17 209 SNARE and Associated Proteins AT5G08080 75.5 7.0e-73 270.8
Cmetu11g1082 . 2 169 SNARE and Associated Proteins AT5G08080 63.1 2.9e-50 195.7
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT5G16830 54.7 1.3e-65 246.9
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT5G46860 59.5 3.6e-68 255.4
Cmetu06g0720 . 1 249 SNARE and Associated Proteins AT4G17730 54.8 2.0e-63 239.6
Cmetu06g0720 . 61 249 SNARE and Associated Proteins AT1G32270 58.9 9.7e-50 194.5
Cmetu10g1254 . 1 336 SNARE and Associated Proteins AT5G05760 65.6 1.7e-110 396.4
Cmetu03g1681 . 8 336 SNARE and Associated Proteins AT3G24350 62.8 3.0e-102 369.0
Cmetu05g1168 . 1 327 SNARE and Associated Proteins AT5G26980 75.5 7.9e-126 447.2
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT5G26980 66.8 5.5e-103 371.3
Cmetu05g1168 . 1 329 SNARE and Associated Proteins AT4G02195 64.0 5.9e-105 377.9
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT4G02195 67.1 7.7e-105 377.5
Cmetu05g1168 . 1 328 SNARE and Associated Proteins AT3G05710 75.4 4.6e-129 458.0
Cmetu01g0565 . 1 318 SNARE and Associated Proteins AT3G05710 64.3 4.9e-99 358.2
Cmetu01g0482 . 1 233 SNARE and Associated Proteins AT1G16240 73.0 1.7e-90 329.3
Cmetu06g0075 . 58 286 SNARE and Associated Proteins AT1G16240 68.6 2.5e-81 298.9
Cmetu01g0482 . 1 233 SNARE and Associated Proteins AT1G79590 73.0 9.7e-90 327.0
Cmetu06g0075 . 58 286 SNARE and Associated Proteins AT1G79590 67.7 8.2e-81 297.4
Cmetu11g2412 . 56 246 SNARE and Associated Proteins AT1G28490 71.7 1.1e-66 250.0
Cmetu04g1845 . 1 264 SNARE and Associated Proteins AT3G09740 78.9 2.4e-112 402.1
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G09740 67.2 2.5e-93 339.0
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G45280 64.9 3.2e-88 322.0
Cmetu04g1845 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 5.4e-88 321.2
Cmetu04g1845 . 1 261 SNARE and Associated Proteins AT3G61450 68.6 3.4e-95 345.1
Cmetu11g0284 . 1 263 SNARE and Associated Proteins AT3G61450 61.4 3.8e-86 315.1
Cmetu03g1342 . 65 308 SNARE and Associated Proteins AT1G51740 73.2 5.7e-92 334.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63