Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cmo02g00885 ATGACCGTAATCGATGTCATCTTCCGAGTCGATTCCATTTGCAAGAAATACGAGAAGTATGATGTCGAGAAACAGCGCGAGCTCAATGCTTATGGTGATGATGTTTTTGCTCGCCTCTACGCCGCCGTCGAACTCGAAATCGAAGCCGCTCTCCAGAAATATGAGAGTGCCTGTACGGAGAAGAATAGGGCTGCTGCAGTTGCGATGAACGCTGAGGTTCGGCGGAAGAAGGCCCGATTGATGGATGAAGTTCCCAAGCTTCATAAATTGGCTCGCAAGAAGATTAAAGGGGTTCCGAAAGAAGAGCTTGAGGTCAGAGGTGATCTTGTTCTTGCGCTTGAAGAGAGGATTAAAGCGATTCCAGATGGGAGTACGACAGGCAAACCATCTGGAGGATGGGCCTCCACCTCATCTAACAATATTAAGTTTGATTCAACAACAGATGGACACTTCGAGAGCGAGTATTTCCAACAAAGCGAAGAATCGAGTCAATTTCGACAGGAGTATGATATGCGGAAGATGAAACAGGACGAAGGTCTGGATGTCATATCTGAAGGGTTGGATATGCTGAAAAATCTAGCCTATGATATGAATGAGGAATTGGATAGGCAAGTTCCATTAATTGACGAGATTGACTCAAAGGTAGACAAGGTGACTAATGAGATGAAAAACACCAATGTTAGGCTCAAGCAAACGCTGAATGAGGTGAGATCCAGCCAAAACTTCTGCATCGATATCATTCTTCTCTGTATAATTCTTGGAATCGCTTCTTACTTGTACAATATATTGAGCGGAAATGGTTGA 804 44.28 MTVIDVIFRVDSICKKYEKYDVEKQRELNAYGDDVFARLYAAVELEIEAALQKYESACTEKNRAAAVAMNAEVRRKKARLMDEVPKLHKLARKKIKGVPKEELEVRGDLVLALEERIKAIPDGSTTGKPSGGWASTSSNNIKFDSTTDGHFESEYFQQSEESSQFRQEYDMRKMKQDEGLDVISEGLDMLKNLAYDMNEELDRQVPLIDEIDSKVDKVTNEMKNTNVRLKQTLNEVRSSQNFCIDIILLCIILGIASYLYNILSGNG 267
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 5474935 5477194 + CmoCh02G008850.1 Cmo02g00885 376482

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cmo02g00885 267 MobiDBLite consensus disorder prediction 121 141 - -
Cmo02g00885 267 Pfam SNARE domain 207 256 IPR000727 -
Cmo02g00885 267 SMART tSNARE_6 165 232 IPR000727 -
Cmo02g00885 267 CDD SNARE_Qc 175 231 - -
Cmo02g00885 267 Gene3D - 152 234 - -
Cmo02g00885 267 ProSitePatterns Syntaxin / epimorphin family signature. 176 215 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cmo02g00885 267 PANTHER SYNTAXIN 1 261 IPR045242 -
Cmo02g00885 267 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 170 232 IPR000727 -
Cmo02g00885 267 PANTHER SYNTAXIN-73 1 261 - -
Cmo02g00885 267 SUPERFAMILY SNARE fusion complex 163 230 - -
Cmo02g00885 267 Coils Coil 208 235 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmo02g00885 K08506 SYP7; syntaxin of plants SYP7 - csv:101211289 425.631
       

WGDs- Genes

Select Gene_1 Gene_2 Event_name
Cmo02g00885 Cmo20g00513 CST
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmo01g01094 Cmo-Chr1:9117464 Cmo02g00885 Cmo-Chr2:5474935 5.97E-123 dispersed
Cmo02g00885 Cmo-Chr2:5474935 Cmo18g01136 Cmo-Chr18:11656051 1.56E-06 dispersed
Cmo14g00195 Cmo-Chr14:879672 Cmo02g00885 Cmo-Chr2:5474935 5.53E-120 wgd
Cmo02g00885 Cmo-Chr2:5474935 Cmo20g00513 Cmo-Chr20:2456641 1.61E-65 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi6g289 . . Bda02g00767 . Bpe01g00179 . . . . . . . . . . Cpe05g00828 . . . . . . . . Cla02g02052 Cam02g2177 Cec02g2216 Cco02g2256 Clacu02g2162 Cmu02g2099 Cre02g2412 . Cone5ag1222 . . . . . Cme11g01789 . Blo14g00167 . . . . . Bma11g00164 Sed05g2859 Cmo02g00885 Cmo20g00513 Cma02g00885 . . Car20g00420 . . Bhi10g00561 Tan05g0265 Cmetu11g0284 . Hepe08g0878 . . . . . . . . . . . . .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmo12g00252 . 443 752 SNARE and Associated Proteins AT3G24350 63.3 1.4e-91 334.0
Cmo05g00672 . 51 348 SNARE and Associated Proteins AT3G24350 62.0 8.8e-86 314.7
Cmo07g01220 CST 1 308 SNARE and Associated Proteins AT1G08560 68.4 1.7e-101 366.7
Cmo03g00262 CST 1 312 SNARE and Associated Proteins AT1G08560 67.7 3.6e-96 349.0
Cmo03g00768 . 387 687 SNARE and Associated Proteins AT2G18260 53.1 2.9e-82 302.8
Cmo14g00363 . 1344 1604 SNARE and Associated Proteins AT3G11820 81.6 2.5e-116 416.0
Cmo06g00530 . 19 279 SNARE and Associated Proteins AT3G11820 77.4 9.0e-111 397.5
Cmo07g00850 . 21 280 SNARE and Associated Proteins AT3G11820 69.6 1.6e-99 360.1
Cmo18g00322 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.6e-94 342.8
Cmo13g00695 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 2.1e-91 333.2
Cmo14g01110 . 44 302 SNARE and Associated Proteins AT3G11820 52.1 6.5e-69 258.5
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT3G52400 64.3 7.0e-93 338.2
Cmo06g00530 . 1 279 SNARE and Associated Proteins AT3G52400 61.5 6.8e-88 321.6
Cmo07g00850 . 1 280 SNARE and Associated Proteins AT3G52400 58.8 4.1e-85 312.4
Cmo13g00695 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.1e-81 300.1
Cmo18g00322 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.5e-79 293.9
Cmo14g01110 . 54 302 SNARE and Associated Proteins AT3G52400 50.2 4.6e-60 229.2
Cmo18g00322 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 1.0e-106 384.0
Cmo13g00695 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.3e-106 383.6
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT4G03330 57.5 2.2e-82 303.1
Cmo06g00530 . 1 284 SNARE and Associated Proteins AT4G03330 56.6 1.1e-81 300.8
Cmo07g00850 . 1 278 SNARE and Associated Proteins AT4G03330 52.8 3.5e-75 279.3
Cmo14g01110 . 54 302 SNARE and Associated Proteins AT4G03330 55.4 1.8e-68 256.9
Cmo18g00322 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 6.0e-128 454.5
Cmo13g00695 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 7.3e-126 447.6
Cmo06g00530 . 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.6e-91 332.8
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT1G61290 61.9 5.0e-90 328.6
Cmo07g00850 . 1 292 SNARE and Associated Proteins AT1G61290 54.9 1.4e-81 300.4
Cmo14g01110 . 52 302 SNARE and Associated Proteins AT1G61290 51.0 4.7e-64 242.3
Cmo18g00322 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 3.2e-126 448.7
Cmo13g00695 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 4.4e-123 438.3
Cmo06g00530 . 1 294 SNARE and Associated Proteins AT1G11250 60.2 7.3e-94 341.3
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT1G11250 62.7 2.8e-93 339.3
Cmo07g00850 . 1 292 SNARE and Associated Proteins AT1G11250 54.5 7.5e-83 304.7
Cmo14g01110 . 37 302 SNARE and Associated Proteins AT1G11250 51.1 8.9e-68 254.6
Cmo14g01110 . 21 325 SNARE and Associated Proteins AT3G03800 73.1 1.7e-114 409.8
Cmo20g00615 CST 1 305 SNARE and Associated Proteins AT3G03800 55.7 5.0e-82 302.0
Cmo14g01110 . 21 220 SNARE and Associated Proteins AT5G08080 77.0 2.5e-78 289.3
Cmo20g00615 CST 1 204 SNARE and Associated Proteins AT5G08080 58.8 1.6e-53 206.8
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.8e-81 299.3
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.4e-80 297.0
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 3.3e-74 275.8
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT4G17730 61.7 7.3e-74 274.6
Cmo16g01226 CST 65 256 SNARE and Associated Proteins AT1G32270 60.9 5.5e-53 205.7
Cmo06g00644 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.3e-51 201.1
Cmo04g01191 CST 25 358 SNARE and Associated Proteins AT5G05760 66.3 6.0e-113 404.8
Cmo04g00161 CST 1 334 SNARE and Associated Proteins AT5G05760 61.5 7.4e-103 371.3
Cmo12g00252 . 443 752 SNARE and Associated Proteins AT3G24350 63.3 1.4e-91 334.0
Cmo05g00672 . 51 348 SNARE and Associated Proteins AT3G24350 62.0 8.8e-86 314.7
Cmo12g01056 CST 1 327 SNARE and Associated Proteins AT5G26980 75.2 1.0e-125 447.2
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT5G26980 66.5 4.2e-103 372.1
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT5G26980 74.6 3.4e-97 352.4
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT4G02195 65.0 2.7e-102 369.4
Cmo12g01056 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.5e-102 369.0
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT4G02195 62.5 3.8e-80 295.8
Cmo12g01056 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.6e-126 449.9
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT3G05710 64.3 2.6e-100 362.8
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT3G05710 72.9 1.9e-98 356.7
Cmo01g01156 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.4e-91 332.0
Cmo09g00974 CCT,CST 3 212 SNARE and Associated Proteins AT1G16240 68.9 5.3e-76 281.6
Cmo16g00959 CCT 38 259 SNARE and Associated Proteins AT1G16240 57.1 1.6e-64 243.4
Cmo01g01156 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.9e-90 329.7
Cmo09g00974 CCT,CST 2 212 SNARE and Associated Proteins AT1G79590 70.0 4.6e-76 282.0
Cmo16g00959 CCT 37 259 SNARE and Associated Proteins AT1G79590 57.5 7.4e-66 248.1
Cmo01g00984 . 5 199 SNARE and Associated Proteins AT1G28490 69.7 1.9e-66 249.6
Cmo17g00043 . 127 314 SNARE and Associated Proteins AT1G28490 53.2 8.5e-38 154.5
Cmo01g01094 . 1 263 SNARE and Associated Proteins AT3G09740 77.4 1.4e-109 393.3
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G09740 76.8 1.2e-108 390.2
Cmo02g00885 CST 1 264 SNARE and Associated Proteins AT3G09740 67.5 6.5e-94 341.3
Cmo01g01094 . 1 263 SNARE and Associated Proteins AT3G45280 63.5 1.7e-86 316.6
Cmo02g00885 CST 1 264 SNARE and Associated Proteins AT3G45280 63.8 6.5e-86 314.7
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G45280 62.9 3.2e-85 312.4
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 1.2e-95 347.1
Cmo01g01094 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 7.5e-95 344.4
Cmo02g00885 CST 1 261 SNARE and Associated Proteins AT3G61450 60.5 3.0e-83 305.8
Cmo04g03046 CST 65 309 SNARE and Associated Proteins AT1G51740 74.4 6.0e-94 341.3
Cmo15g00129 CST 65 284 SNARE and Associated Proteins AT1G51740 61.5 5.9e-65 245.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cmo02g00885 Cmo_Chr02 FPKM 1.354411 2.122355 1.614368 1.427792 3.994747 4.108532 2.977344 2.416443 2.136308 1.840436