Cucurbitales platform

Gene search

Sequence information

Select	Gene	Cds	Cds_length	GC_content	Pep	Pep_length
	Cmo03g00262	ATGAATGACTTGATGACCAAATCGTTCACGAGCTATGTCGATCTGAAGAAGGCCGCCATGAAAGATATCGACCTCGAAGCCGGTTTAGAAATGGCATCGTCCGCTCCTGGCGACAATGGCGACATGGGTCTCTTTCTCGAAGAGGCCGAGAAGGTGAAAACCGAGATGGGTTCGATTAGAGAGATTTTAGTGAAGCTCCAACAAGCCAATGAAGAGACAAAGTCGGCTCATAAACCCGAAACCCTCAAATTGCTTCGGAATACGATCAATGTCGATATTGTAACAGTTCTGAAAAAAGCTCGATCCATCCGATCCCACCTCGAGGAAATGGACCGTGCCAATGCTGCCAAGAAACGTCTCTCGGGTAGTAAAGAGGGCACTGCCATTTACAGAACACGAATTGCGGTGACGAACGGGTTACGAAAGAAGTTAAAGGAGCTGATGATGGAGTTTCAGAGCTTGAGGCAGAGGATGATGACGGAGTATAAGGAGACGGTAGGACGGCGATACTTTACAGTGACGGGGGAGAAGGCGAATGAGGAGGTGATAGAGAGGATAATATCAGATGGCGGGGAGGAGTTTTTGGGGAGGGCGATAAAGGAGCACGGGGAAGGTGGGAAGGTGGCGGTGGCGGAGACGGTGGAGGAGATACAGGACCGACACGGGGCGGCGAAGGAAATAGAGAAGAGCTTGTTGGAGCTGCACCAAGTGTTCTTGGACATGGCGGTGATGGTGGAGGCACAAGGGGAGAAGATGGATAACATAGAACATCATGTGATGAATGCTTCGCAGTATGTTAGGGATGGGACAAAGGAATTGAAGAGTGCTAAGGAATTGCAAAGGAGTAGTAGAAAATGTATGTGTTTGGGGATTTTGCTATTGCTTTTGATTATTTTGGTTGTTGTTGTTCCTATTAGTGTTAGTTTTGGAAGTTCTTGA	939	48.03	MNDLMTKSFTSYVDLKKAAMKDIDLEAGLEMASSAPGDNGDMGLFLEEAEKVKTEMGSIREILVKLQQANEETKSAHKPETLKLLRNTINVDIVTVLKKARSIRSHLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEKANEEVIERIISDGGEEFLGRAIKEHGEGGKVAVAETVEEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDNIEHHVMNASQYVRDGTKELKSAKELQRSSRKCMCLGILLLLLIILVVVVPISVSFGSS	312

Gff information

Chromosome	Start	End	Strand	Old_gene	Gene	Num
3	3914507	3915775	-	CmoCh03G002620.1	Cmo03g00262	377725

Annotation

Seq ID	Length	Analysis	Description	Start	End	IPR	GO
Cmo03g00262	312	ProSiteProfiles	t-SNARE coiled-coil homology domain profile.	214	276	IPR000727	-
Cmo03g00262	312	SUPERFAMILY	t-snare proteins	41	269	IPR010989	GO:0016020\|GO:0016192
Cmo03g00262	312	PANTHER	SYNTAXIN	4	305	IPR045242	-
Cmo03g00262	312	SMART	tSNARE_6	209	276	IPR000727	-
Cmo03g00262	312	CDD	SNARE_syntaxin1-like	213	274	-	-
Cmo03g00262	312	PANTHER	SYNTAXIN-RELATED PROTEIN KNOLLE	4	305	-	-
Cmo03g00262	312	Pfam	SNARE domain	251	302	IPR000727	-
Cmo03g00262	312	ProSitePatterns	Syntaxin / epimorphin family signature.	220	260	IPR006012	GO:0005484\|GO:0006886\|GO:0016020
Cmo03g00262	312	CDD	SynN	42	198	IPR006011	GO:0016020
Cmo03g00262	312	Gene3D	-	209	310	-	-
Cmo03g00262	312	Pfam	Syntaxin	45	249	IPR006011	GO:0016020
Cmo03g00262	312	SMART	SynN_4	37	163	IPR006011	GO:0016020
Cmo03g00262	312	Coils	Coil	137	157	-	-
Cmo03g00262	312	Gene3D	-	42	169	-	-

Pathway

Select	Query	KO	Definition	Second KO	KEGG Genes ID	GHOSTX Score
	Cmo03g00262	K08486	STX1B_2_3; syntaxin 1B/2/3	-	csv:101220775	505.753

WGDs- Genes

Select	Gene_1	Gene_2	Event_name
	Cmo03g00262	Cmo07g01220	CST

Dupl-types

Select	Gene1	Location1	Gene2	Location2	E-value	Duplicated-type
	Cmo03g00262	Cmo-Chr3:3914507	Cmo13g00695	Cmo-Chr13:7115501	2.80E-96	dispersed
	Cmo03g00262	Cmo-Chr3:3914507	Cmo07g01220	Cmo-Chr7:6644227	1.47E-180	wgd

Deco-Alignment

Select	Vvi1	Blo1	Blo2	Bda1	Bda2	Bpe1	Bpe2	Bma1	Bma2	Cmo1	Cmo2	Cma1	Cma2	Car1	Car2	Sed1	Cpe1	Cpe2	Bhi1	Tan1	Cmetu1	Lac1	Hepe1	Mch1	Lcy1	Cla1	Cam1	Cec1	Cco1	Clacu1	Cmu1	Cre1	Cone1	Cone2	Cone3	Cone4	Lsi1	Csa1	Chy1	Cme1	Blo3	Blo4	Bda3	Bda4	Bpe3	Bpe4	Bma3	Bma4	Sed2	Cmo3	Cmo4	Cma3	Cma4	Car3	Car4	Cpe3	Cpe4	Bhi2	Tan2	Cmetu2	Lac2	Hepe2	Mch2	Lcy2	Cla2	Cam2	Cec2	Cco2	Clacu2	Cmu2	Cre2	Lsi2	Csa2	Chy2	Cme2
	Vvi8g156	.	.	.	.	.	.	.	.	.	.	Cma03g00248	.	Car03g00212	.	Sed14g0695	Cpe10g01038	Cpe08g00962	Bhi03g02299	Tan03g0640	Cmetu08g0109	.	Hepe04g0635	.	.	.	.	.	.	.	.	.	Cone3ag0557	Cone10ag0552	Cone13ag0475	.	Lsi01g01659	Csa04g01137	.	Cme04g01796	.	.	.	.	.	.	.	.	.	Cmo03g00262	Cmo07g01220	.	.	.	.	.	.	Bhi11g01551	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	.	Cme08g02007

Syn-Families

Gene	Event_type	S_start	S_end	Function	Ath_gene	Identity(%)	E-value	Score
Cmo12g00252	.	443	752	SNARE and Associated Proteins	AT3G24350	63.3	1.4e-91	334.0
Cmo05g00672	.	51	348	SNARE and Associated Proteins	AT3G24350	62.0	8.8e-86	314.7
Cmo07g01220	CST	1	308	SNARE and Associated Proteins	AT1G08560	68.4	1.7e-101	366.7
Cmo03g00262	CST	1	312	SNARE and Associated Proteins	AT1G08560	67.7	3.6e-96	349.0
Cmo03g00768	.	387	687	SNARE and Associated Proteins	AT2G18260	53.1	2.9e-82	302.8
Cmo14g00363	.	1344	1604	SNARE and Associated Proteins	AT3G11820	81.6	2.5e-116	416.0
Cmo06g00530	.	19	279	SNARE and Associated Proteins	AT3G11820	77.4	9.0e-111	397.5
Cmo07g00850	.	21	280	SNARE and Associated Proteins	AT3G11820	69.6	1.6e-99	360.1
Cmo18g00322	.	31	281	SNARE and Associated Proteins	AT3G11820	67.3	2.6e-94	342.8
Cmo13g00695	.	31	281	SNARE and Associated Proteins	AT3G11820	66.1	2.1e-91	333.2
Cmo14g01110	.	44	302	SNARE and Associated Proteins	AT3G11820	52.1	6.5e-69	258.5
Cmo14g00363	.	1326	1604	SNARE and Associated Proteins	AT3G52400	64.3	7.0e-93	338.2
Cmo06g00530	.	1	279	SNARE and Associated Proteins	AT3G52400	61.5	6.8e-88	321.6
Cmo07g00850	.	1	280	SNARE and Associated Proteins	AT3G52400	58.8	4.1e-85	312.4
Cmo13g00695	.	1	281	SNARE and Associated Proteins	AT3G52400	56.5	2.1e-81	300.1
Cmo18g00322	.	1	281	SNARE and Associated Proteins	AT3G52400	55.3	1.5e-79	293.9
Cmo14g01110	.	54	302	SNARE and Associated Proteins	AT3G52400	50.2	4.6e-60	229.2
Cmo18g00322	.	1	295	SNARE and Associated Proteins	AT4G03330	69.8	1.0e-106	384.0
Cmo13g00695	.	1	299	SNARE and Associated Proteins	AT4G03330	67.5	1.3e-106	383.6
Cmo14g00363	.	1326	1604	SNARE and Associated Proteins	AT4G03330	57.5	2.2e-82	303.1
Cmo06g00530	.	1	284	SNARE and Associated Proteins	AT4G03330	56.6	1.1e-81	300.8
Cmo07g00850	.	1	278	SNARE and Associated Proteins	AT4G03330	52.8	3.5e-75	279.3
Cmo14g01110	.	54	302	SNARE and Associated Proteins	AT4G03330	55.4	1.8e-68	256.9
Cmo18g00322	.	1	303	SNARE and Associated Proteins	AT1G61290	78.5	6.0e-128	454.5
Cmo13g00695	.	1	303	SNARE and Associated Proteins	AT1G61290	77.2	7.3e-126	447.6
Cmo06g00530	.	1	294	SNARE and Associated Proteins	AT1G61290	59.8	2.6e-91	332.8
Cmo14g00363	.	1326	1604	SNARE and Associated Proteins	AT1G61290	61.9	5.0e-90	328.6
Cmo07g00850	.	1	292	SNARE and Associated Proteins	AT1G61290	54.9	1.4e-81	300.4
Cmo14g01110	.	52	302	SNARE and Associated Proteins	AT1G61290	51.0	4.7e-64	242.3
Cmo18g00322	.	1	303	SNARE and Associated Proteins	AT1G11250	78.2	3.2e-126	448.7
Cmo13g00695	.	1	303	SNARE and Associated Proteins	AT1G11250	76.6	4.4e-123	438.3
Cmo06g00530	.	1	294	SNARE and Associated Proteins	AT1G11250	60.2	7.3e-94	341.3
Cmo14g00363	.	1326	1604	SNARE and Associated Proteins	AT1G11250	62.7	2.8e-93	339.3
Cmo07g00850	.	1	292	SNARE and Associated Proteins	AT1G11250	54.5	7.5e-83	304.7
Cmo14g01110	.	37	302	SNARE and Associated Proteins	AT1G11250	51.1	8.9e-68	254.6
Cmo14g01110	.	21	325	SNARE and Associated Proteins	AT3G03800	73.1	1.7e-114	409.8
Cmo20g00615	CST	1	305	SNARE and Associated Proteins	AT3G03800	55.7	5.0e-82	302.0
Cmo14g01110	.	21	220	SNARE and Associated Proteins	AT5G08080	77.0	2.5e-78	289.3
Cmo20g00615	CST	1	204	SNARE and Associated Proteins	AT5G08080	58.8	1.6e-53	206.8
Cmo16g01226	CST	1	256	SNARE and Associated Proteins	AT5G16830	59.9	1.1e-75	280.8
Cmo06g00644	CST	1	256	SNARE and Associated Proteins	AT5G16830	59.9	1.1e-75	280.8
Cmo06g00644	CST	1	256	SNARE and Associated Proteins	AT5G46860	66.8	2.8e-81	299.3
Cmo16g01226	CST	1	256	SNARE and Associated Proteins	AT5G46860	66.8	1.4e-80	297.0
Cmo06g00644	CST	1	256	SNARE and Associated Proteins	AT4G17730	61.3	3.3e-74	275.8
Cmo16g01226	CST	1	256	SNARE and Associated Proteins	AT4G17730	61.7	7.3e-74	274.6
Cmo16g01226	CST	65	256	SNARE and Associated Proteins	AT1G32270	60.9	5.5e-53	205.7
Cmo06g00644	CST	65	256	SNARE and Associated Proteins	AT1G32270	60.4	1.3e-51	201.1
Cmo04g01191	CST	25	358	SNARE and Associated Proteins	AT5G05760	66.3	6.0e-113	404.8
Cmo04g00161	CST	1	334	SNARE and Associated Proteins	AT5G05760	61.5	7.4e-103	371.3
Cmo12g00252	.	443	752	SNARE and Associated Proteins	AT3G24350	63.3	1.4e-91	334.0
Cmo05g00672	.	51	348	SNARE and Associated Proteins	AT3G24350	62.0	8.8e-86	314.7
Cmo12g01056	CST	1	327	SNARE and Associated Proteins	AT5G26980	75.2	1.0e-125	447.2
Cmo17g01031	.	1	320	SNARE and Associated Proteins	AT5G26980	66.5	4.2e-103	372.1
Cmo05g01102	CST	1	268	SNARE and Associated Proteins	AT5G26980	74.6	3.4e-97	352.4
Cmo17g01031	.	1	320	SNARE and Associated Proteins	AT4G02195	65.0	2.7e-102	369.4
Cmo12g01056	CST	1	329	SNARE and Associated Proteins	AT4G02195	62.8	3.5e-102	369.0
Cmo05g01102	CST	1	268	SNARE and Associated Proteins	AT4G02195	62.5	3.8e-80	295.8
Cmo12g01056	CST	1	328	SNARE and Associated Proteins	AT3G05710	73.9	1.6e-126	449.9
Cmo17g01031	.	1	320	SNARE and Associated Proteins	AT3G05710	64.3	2.6e-100	362.8
Cmo05g01102	CST	1	268	SNARE and Associated Proteins	AT3G05710	72.9	1.9e-98	356.7
Cmo01g01156	CCT,CST	1	233	SNARE and Associated Proteins	AT1G16240	73.4	3.4e-91	332.0
Cmo09g00974	CCT,CST	3	212	SNARE and Associated Proteins	AT1G16240	68.9	5.3e-76	281.6
Cmo16g00959	CCT	38	259	SNARE and Associated Proteins	AT1G16240	57.1	1.6e-64	243.4
Cmo01g01156	CCT,CST	1	233	SNARE and Associated Proteins	AT1G79590	73.0	1.9e-90	329.7
Cmo09g00974	CCT,CST	2	212	SNARE and Associated Proteins	AT1G79590	70.0	4.6e-76	282.0
Cmo16g00959	CCT	37	259	SNARE and Associated Proteins	AT1G79590	57.5	7.4e-66	248.1
Cmo01g00984	.	5	199	SNARE and Associated Proteins	AT1G28490	69.7	1.9e-66	249.6
Cmo17g00043	.	127	314	SNARE and Associated Proteins	AT1G28490	53.2	8.5e-38	154.5
Cmo01g01094	.	1	263	SNARE and Associated Proteins	AT3G09740	77.4	1.4e-109	393.3
Cmo14g00195	.	1	261	SNARE and Associated Proteins	AT3G09740	76.8	1.2e-108	390.2
Cmo02g00885	CST	1	264	SNARE and Associated Proteins	AT3G09740	67.5	6.5e-94	341.3
Cmo01g01094	.	1	263	SNARE and Associated Proteins	AT3G45280	63.5	1.7e-86	316.6
Cmo02g00885	CST	1	264	SNARE and Associated Proteins	AT3G45280	63.8	6.5e-86	314.7
Cmo14g00195	.	1	261	SNARE and Associated Proteins	AT3G45280	62.9	3.2e-85	312.4
Cmo14g00195	.	1	261	SNARE and Associated Proteins	AT3G61450	69.3	1.2e-95	347.1
Cmo01g01094	.	1	261	SNARE and Associated Proteins	AT3G61450	68.9	7.5e-95	344.4
Cmo02g00885	CST	1	261	SNARE and Associated Proteins	AT3G61450	60.5	3.0e-83	305.8
Cmo04g03046	CST	65	309	SNARE and Associated Proteins	AT1G51740	74.4	6.0e-94	341.3
Cmo15g00129	CST	65	284	SNARE and Associated Proteins	AT1G51740	61.5	5.9e-65	245.0

Syn-Orthogroups

Select	Orthogroup	Bda	Bhi	Blo	Bma	Bpe	Cam	Car	Cco	Cec	Chy	Cla	Clacu	Cma	Cme	Cmetu	Cmo	Cmu	Cone	Cpe	Cre	Csa	HCH	Hepe	Lac	Lcy	Lsi	Mch	Sed	Tan	Vvi	Total
	OG0010730	0	1	0	0	0	1	2	1	1	1	1	1	2	1	1	2	1	2	2	1	1	1	1	1	1	1	1	2	1	1	32

Transcriptome

Select	Gene	Chr	Type	da1	da2	da3	da4	da5	da6	da7	da8	da9	da10
	Cmo03g00262	Cmo_Chr03	FPKM	0.0	0.0	0.0	0.0	0.0	0.0	0.0	0.0	0.0	0.0