Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cmo09g00974 ATGGAATACAATGAAGCCATGAAACTCTCTGAAGATATCAATGGCATGATTTCTGGGAGAAGTTCTGCTTCTGGACCAGAAGCTCAGCGTCATGCCTCAGCTATACGCAGGAAGATCACAATATTGGGTACCAGACTTGATACCTTGCAGACTCAGTTACCCAAGCTTCAAGGAAAGCAACCAATACCGGAGAAAGAGATGAATCGACGCAGGGATATGATAGCGAATTTGAGATCGAAAGCTAACCAGATGGCTTCAACTTTGAACATGTCTAACTTTGCTAACCGAGATAGCTTACTTGGTCCAGAAATAAAGCCAGCAGAGAATAGGACGGAAGGCTTAGACAACCGAGGCCTACTCGAGCAAGATGAAGGCCTCGAGAAACTGGAAGGGACTATAATGAGCACAAAACATATTGCATTGGCTGTCAATGAAGAACTTAGCCTTCACACGAGACTTATCGATGATTTGGATGAACATGTCGATGTTACAGATTCCCGATTACGGAGAGTGCAGAAGAGGCTGGCAATAATGAACAAGCGGACCAAGGGTGGATGCACTTGCATGTCAATGATTTCATCAGTTGTTGGAATTGTCGTTCTCATCACTCTCATATGGCTACTCATCAAGTATTTGTAA 639 43.82 MEYNEAMKLSEDINGMISGRSSASGPEAQRHASAIRRKITILGTRLDTLQTQLPKLQGKQPIPEKEMNRRRDMIANLRSKANQMASTLNMSNFANRDSLLGPEIKPAENRTEGLDNRGLLEQDEGLEKLEGTIMSTKHIALAVNEELSLHTRLIDDLDEHVDVTDSRLRRVQKRLAIMNKRTKGGCTCMSMISSVVGIVVLITLIWLLIKYL 212
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
9 5158698 5162529 + CmoCh09G009740.1 Cmo09g00974 388976

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cmo09g00974 212 PANTHER TARGET SNARE COILED-COIL DOMAIN-CONTAINING PROTEIN-RELATED 3 204 - -
Cmo09g00974 212 CDD SNARE_Qc 121 176 - -
Cmo09g00974 212 Gene3D - 118 180 - -
Cmo09g00974 212 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 116 178 IPR000727 -
Cmo09g00974 212 SUPERFAMILY SNARE fusion complex 120 177 - -
Cmo09g00974 212 SMART tSNARE_6 110 178 IPR000727 -
Cmo09g00974 212 PANTHER SYNTAXIN 3 204 IPR045242 -
Cmo09g00974 212 Pfam SNARE domain 153 203 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmo09g00974 K08503 SYP5; syntaxin of plants SYP5 - csv:101208669 347.821
       

WGDs- Genes

Select Gene_1 Gene_2 Event_name
Cmo09g00974 Cmo16g00959 CCT
Cmo01g01156 Cmo09g00974 CST
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmo09g00974 Cmo-Chr9:5158698 Cmo16g00959 Cmo-Chr16:6354364 4.92E-94 dispersed
Cmo01g00984 Cmo-Chr1:6509852 Cmo09g00974 Cmo-Chr9:5158698 8.11E-10 transposed
Cmo17g00043 Cmo-Chr17:213771 Cmo09g00974 Cmo-Chr9:5158698 1.13E-07 transposed
Cmo01g01156 Cmo-Chr1:9455895 Cmo09g00974 Cmo-Chr9:5158698 2.78E-138 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi19g583 Blo03g00538 . Bda07g00381 Bda09g00411 . Bpe08g01109 . . Cmo16g00959 . Cma01g01111 Cma09g00975 Car01g00980 Car09g00889 Sed07g2705 Cpe06g00787 Cpe02g00792 Bhi09g01700 Tan01g3132 Cmetu01g0482 . Hepe01g1245 Mch11g1220 . . . . . . . . Cone6ag0041 Cone9ag0047 Cone14ag1185 Cone15ag1202 Lsi02g01877 . . . . . Bda05g00693 . . Bpe03g00767 Bma07g01281 Bma14g00320 . Cmo01g01156 Cmo09g00974 . Cma16g00924 . Car16g00895 Cpe14g00748 . . . . . . . . Cla09g01036 Cam09g1092 Cec09g1092 Cco09g1113 . . Cre09g1057 . . Chy01g01059 Cme01g00994
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmo12g00252 . 443 752 SNARE and Associated Proteins AT3G24350 63.3 1.4e-91 334.0
Cmo05g00672 . 51 348 SNARE and Associated Proteins AT3G24350 62.0 8.8e-86 314.7
Cmo07g01220 CST 1 308 SNARE and Associated Proteins AT1G08560 68.4 1.7e-101 366.7
Cmo03g00262 CST 1 312 SNARE and Associated Proteins AT1G08560 67.7 3.6e-96 349.0
Cmo03g00768 . 387 687 SNARE and Associated Proteins AT2G18260 53.1 2.9e-82 302.8
Cmo14g00363 . 1344 1604 SNARE and Associated Proteins AT3G11820 81.6 2.5e-116 416.0
Cmo06g00530 . 19 279 SNARE and Associated Proteins AT3G11820 77.4 9.0e-111 397.5
Cmo07g00850 . 21 280 SNARE and Associated Proteins AT3G11820 69.6 1.6e-99 360.1
Cmo18g00322 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.6e-94 342.8
Cmo13g00695 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 2.1e-91 333.2
Cmo14g01110 . 44 302 SNARE and Associated Proteins AT3G11820 52.1 6.5e-69 258.5
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT3G52400 64.3 7.0e-93 338.2
Cmo06g00530 . 1 279 SNARE and Associated Proteins AT3G52400 61.5 6.8e-88 321.6
Cmo07g00850 . 1 280 SNARE and Associated Proteins AT3G52400 58.8 4.1e-85 312.4
Cmo13g00695 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.1e-81 300.1
Cmo18g00322 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.5e-79 293.9
Cmo14g01110 . 54 302 SNARE and Associated Proteins AT3G52400 50.2 4.6e-60 229.2
Cmo18g00322 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 1.0e-106 384.0
Cmo13g00695 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.3e-106 383.6
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT4G03330 57.5 2.2e-82 303.1
Cmo06g00530 . 1 284 SNARE and Associated Proteins AT4G03330 56.6 1.1e-81 300.8
Cmo07g00850 . 1 278 SNARE and Associated Proteins AT4G03330 52.8 3.5e-75 279.3
Cmo14g01110 . 54 302 SNARE and Associated Proteins AT4G03330 55.4 1.8e-68 256.9
Cmo18g00322 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 6.0e-128 454.5
Cmo13g00695 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 7.3e-126 447.6
Cmo06g00530 . 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.6e-91 332.8
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT1G61290 61.9 5.0e-90 328.6
Cmo07g00850 . 1 292 SNARE and Associated Proteins AT1G61290 54.9 1.4e-81 300.4
Cmo14g01110 . 52 302 SNARE and Associated Proteins AT1G61290 51.0 4.7e-64 242.3
Cmo18g00322 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 3.2e-126 448.7
Cmo13g00695 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 4.4e-123 438.3
Cmo06g00530 . 1 294 SNARE and Associated Proteins AT1G11250 60.2 7.3e-94 341.3
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT1G11250 62.7 2.8e-93 339.3
Cmo07g00850 . 1 292 SNARE and Associated Proteins AT1G11250 54.5 7.5e-83 304.7
Cmo14g01110 . 37 302 SNARE and Associated Proteins AT1G11250 51.1 8.9e-68 254.6
Cmo14g01110 . 21 325 SNARE and Associated Proteins AT3G03800 73.1 1.7e-114 409.8
Cmo20g00615 CST 1 305 SNARE and Associated Proteins AT3G03800 55.7 5.0e-82 302.0
Cmo14g01110 . 21 220 SNARE and Associated Proteins AT5G08080 77.0 2.5e-78 289.3
Cmo20g00615 CST 1 204 SNARE and Associated Proteins AT5G08080 58.8 1.6e-53 206.8
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.8e-81 299.3
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.4e-80 297.0
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 3.3e-74 275.8
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT4G17730 61.7 7.3e-74 274.6
Cmo16g01226 CST 65 256 SNARE and Associated Proteins AT1G32270 60.9 5.5e-53 205.7
Cmo06g00644 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.3e-51 201.1
Cmo04g01191 CST 25 358 SNARE and Associated Proteins AT5G05760 66.3 6.0e-113 404.8
Cmo04g00161 CST 1 334 SNARE and Associated Proteins AT5G05760 61.5 7.4e-103 371.3
Cmo12g00252 . 443 752 SNARE and Associated Proteins AT3G24350 63.3 1.4e-91 334.0
Cmo05g00672 . 51 348 SNARE and Associated Proteins AT3G24350 62.0 8.8e-86 314.7
Cmo12g01056 CST 1 327 SNARE and Associated Proteins AT5G26980 75.2 1.0e-125 447.2
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT5G26980 66.5 4.2e-103 372.1
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT5G26980 74.6 3.4e-97 352.4
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT4G02195 65.0 2.7e-102 369.4
Cmo12g01056 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.5e-102 369.0
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT4G02195 62.5 3.8e-80 295.8
Cmo12g01056 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.6e-126 449.9
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT3G05710 64.3 2.6e-100 362.8
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT3G05710 72.9 1.9e-98 356.7
Cmo01g01156 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.4e-91 332.0
Cmo09g00974 CCT,CST 3 212 SNARE and Associated Proteins AT1G16240 68.9 5.3e-76 281.6
Cmo16g00959 CCT 38 259 SNARE and Associated Proteins AT1G16240 57.1 1.6e-64 243.4
Cmo01g01156 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.9e-90 329.7
Cmo09g00974 CCT,CST 2 212 SNARE and Associated Proteins AT1G79590 70.0 4.6e-76 282.0
Cmo16g00959 CCT 37 259 SNARE and Associated Proteins AT1G79590 57.5 7.4e-66 248.1
Cmo01g00984 . 5 199 SNARE and Associated Proteins AT1G28490 69.7 1.9e-66 249.6
Cmo17g00043 . 127 314 SNARE and Associated Proteins AT1G28490 53.2 8.5e-38 154.5
Cmo01g01094 . 1 263 SNARE and Associated Proteins AT3G09740 77.4 1.4e-109 393.3
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G09740 76.8 1.2e-108 390.2
Cmo02g00885 CST 1 264 SNARE and Associated Proteins AT3G09740 67.5 6.5e-94 341.3
Cmo01g01094 . 1 263 SNARE and Associated Proteins AT3G45280 63.5 1.7e-86 316.6
Cmo02g00885 CST 1 264 SNARE and Associated Proteins AT3G45280 63.8 6.5e-86 314.7
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G45280 62.9 3.2e-85 312.4
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 1.2e-95 347.1
Cmo01g01094 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 7.5e-95 344.4
Cmo02g00885 CST 1 261 SNARE and Associated Proteins AT3G61450 60.5 3.0e-83 305.8
Cmo04g03046 CST 65 309 SNARE and Associated Proteins AT1G51740 74.4 6.0e-94 341.3
Cmo15g00129 CST 65 284 SNARE and Associated Proteins AT1G51740 61.5 5.9e-65 245.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002063 3 5 2 3 2 1 3 1 2 1 1 1 3 2 2 3 1 4 3 1 2 2 1 2 2 2 1 5 3 1 65
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cmo09g00974 Cmo_Chr09 FPKM 25.650192 27.505806 26.954311 30.13133 25.89924 21.045595 23.12509 36.897011 34.479305 36.468655