Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cmo13g00695 ATGAACGACTTGTTCTCGAATTCGTTCAAGCAATACACGGATCTGAAGCAACAGGCGTCTGTGGACGGCATGGAGTCTGGGAATGAGACTGTGAATTTGGACACGTTCTTCGAGGATGTCGAGAATGTTAAAGACGACATGAAACAGGTCGAGAATTTGTACAAGAAATTGCAACAGAACAATGAGGAATGCAAGATTGTCCACAATGCCAAGACGATGAAGGAGCTGAGGGGCAGAATGGAGGCCGATGTCGCCCAGGTTCTGAAACGAGTCAAAATGATTAAAGGCAAACTCGAGGCTCTGGATCGTTCCAACGCCGCTCACCGCAGCCTCCCAGGTTGCGGCCCTGGCTCCTCCGCCGACCGAACCCGAACCTCCGTCGTCAGCGGCTTGGGGAAGAAGCTCAAAGATGTCATGGATGAGTTTCAAGGCCTCAGAGGTCGAATGAACGCCGAATACAAAGAAACCATCGAGCGCAGGTACTTCACAGTGACAGGGCAGAAAGCCGACGAAGAGACAATAGAGAATTTGATAGCAAGTGGGGAAAGCGAGAGCTTCCTCCAGAAGGCAATTCAAGAACAGGGGAGGGGTCAGATAATGGACACAATCTCAGAGATTCAGGAGCGACACGACGCTGTGAAGGAGATAGAGAAGAATTTGTTAGAGCTGCATCAAATATTCTTGGACATGGCGGCGCTGGTCGAGGCACAAGGGCACCAGCTGAACGACATCGAGAGCCATGTCGCGCATGCAAACTCGTTCGTGAGAAGAGGAACAGAGCAGCTTCAGGAAGCCAGAGAGATACAGAAGAGCTCGAGGAAGTGGACTTGCTATGCCATTATCTTGGGGGTTGTTCTTATTATCGTCATCCTCTTCCCGATCTTGACTACAATTTTACCTCATTTGTTGTAG 912 50.0 MNDLFSNSFKQYTDLKQQASVDGMESGNETVNLDTFFEDVENVKDDMKQVENLYKKLQQNNEECKIVHNAKTMKELRGRMEADVAQVLKRVKMIKGKLEALDRSNAAHRSLPGCGPGSSADRTRTSVVSGLGKKLKDVMDEFQGLRGRMNAEYKETIERRYFTVTGQKADEETIENLIASGESESFLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQIFLDMAALVEAQGHQLNDIESHVAHANSFVRRGTEQLQEAREIQKSSRKWTCYAIILGVVLIIVILFPILTTILPHLL 303
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
13 7115501 7116682 - CmoCh13G006950.1 Cmo13g00695 394750

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cmo13g00695 303 Pfam SNARE domain 240 291 IPR000727 -
Cmo13g00695 303 Gene3D - 193 298 - -
Cmo13g00695 303 CDD SNARE_syntaxin1-like 202 264 - -
Cmo13g00695 303 Pfam Syntaxin 36 238 IPR006011 GO:0016020
Cmo13g00695 303 CDD SynN 33 190 IPR006011 GO:0016020
Cmo13g00695 303 Gene3D - 33 160 - -
Cmo13g00695 303 SMART SynN_4 28 154 IPR006011 GO:0016020
Cmo13g00695 303 SMART tSNARE_6 198 265 IPR000727 -
Cmo13g00695 303 ProSitePatterns Syntaxin / epimorphin family signature. 209 248 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cmo13g00695 303 PANTHER SYNTAXIN 6 295 IPR045242 -
Cmo13g00695 303 PANTHER SYNTAXIN-124-RELATED 6 295 - -
Cmo13g00695 303 Coils Coil 33 67 - -
Cmo13g00695 303 SUPERFAMILY t-snare proteins 32 258 IPR010989 GO:0016020|GO:0016192
Cmo13g00695 303 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 203 265 IPR000727 -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmo13g00695 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101217140 516.924
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmo03g00262 Cmo-Chr3:3914507 Cmo13g00695 Cmo-Chr13:7115501 2.80E-96 dispersed
Cmo07g00850 Cmo-Chr7:4017505 Cmo13g00695 Cmo-Chr13:7115501 7.68E-114 dispersed
Cmo07g01220 Cmo-Chr7:6644227 Cmo13g00695 Cmo-Chr13:7115501 3.78E-101 dispersed
Cmo13g00695 Cmo-Chr13:7115501 Cmo14g00363 Cmo-Chr14:1665244 2.14E-109 dispersed
Cmo16g01226 Cmo-Chr16:8783964 Cmo13g00695 Cmo-Chr13:7115501 2.49E-11 dispersed
Cmo17g01031 Cmo-Chr17:8784234 Cmo13g00695 Cmo-Chr13:7115501 4.31E-06 dispersed
Cmo13g00695 Cmo-Chr13:7115501 Cmo18g00322 Cmo-Chr18:2085688 0 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmo12g00252 . 443 752 SNARE and Associated Proteins AT3G24350 63.3 1.4e-91 334.0
Cmo05g00672 . 51 348 SNARE and Associated Proteins AT3G24350 62.0 8.8e-86 314.7
Cmo07g01220 CST 1 308 SNARE and Associated Proteins AT1G08560 68.4 1.7e-101 366.7
Cmo03g00262 CST 1 312 SNARE and Associated Proteins AT1G08560 67.7 3.6e-96 349.0
Cmo03g00768 . 387 687 SNARE and Associated Proteins AT2G18260 53.1 2.9e-82 302.8
Cmo14g00363 . 1344 1604 SNARE and Associated Proteins AT3G11820 81.6 2.5e-116 416.0
Cmo06g00530 . 19 279 SNARE and Associated Proteins AT3G11820 77.4 9.0e-111 397.5
Cmo07g00850 . 21 280 SNARE and Associated Proteins AT3G11820 69.6 1.6e-99 360.1
Cmo18g00322 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.6e-94 342.8
Cmo13g00695 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 2.1e-91 333.2
Cmo14g01110 . 44 302 SNARE and Associated Proteins AT3G11820 52.1 6.5e-69 258.5
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT3G52400 64.3 7.0e-93 338.2
Cmo06g00530 . 1 279 SNARE and Associated Proteins AT3G52400 61.5 6.8e-88 321.6
Cmo07g00850 . 1 280 SNARE and Associated Proteins AT3G52400 58.8 4.1e-85 312.4
Cmo13g00695 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.1e-81 300.1
Cmo18g00322 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.5e-79 293.9
Cmo14g01110 . 54 302 SNARE and Associated Proteins AT3G52400 50.2 4.6e-60 229.2
Cmo18g00322 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 1.0e-106 384.0
Cmo13g00695 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.3e-106 383.6
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT4G03330 57.5 2.2e-82 303.1
Cmo06g00530 . 1 284 SNARE and Associated Proteins AT4G03330 56.6 1.1e-81 300.8
Cmo07g00850 . 1 278 SNARE and Associated Proteins AT4G03330 52.8 3.5e-75 279.3
Cmo14g01110 . 54 302 SNARE and Associated Proteins AT4G03330 55.4 1.8e-68 256.9
Cmo18g00322 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 6.0e-128 454.5
Cmo13g00695 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 7.3e-126 447.6
Cmo06g00530 . 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.6e-91 332.8
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT1G61290 61.9 5.0e-90 328.6
Cmo07g00850 . 1 292 SNARE and Associated Proteins AT1G61290 54.9 1.4e-81 300.4
Cmo14g01110 . 52 302 SNARE and Associated Proteins AT1G61290 51.0 4.7e-64 242.3
Cmo18g00322 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 3.2e-126 448.7
Cmo13g00695 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 4.4e-123 438.3
Cmo06g00530 . 1 294 SNARE and Associated Proteins AT1G11250 60.2 7.3e-94 341.3
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT1G11250 62.7 2.8e-93 339.3
Cmo07g00850 . 1 292 SNARE and Associated Proteins AT1G11250 54.5 7.5e-83 304.7
Cmo14g01110 . 37 302 SNARE and Associated Proteins AT1G11250 51.1 8.9e-68 254.6
Cmo14g01110 . 21 325 SNARE and Associated Proteins AT3G03800 73.1 1.7e-114 409.8
Cmo20g00615 CST 1 305 SNARE and Associated Proteins AT3G03800 55.7 5.0e-82 302.0
Cmo14g01110 . 21 220 SNARE and Associated Proteins AT5G08080 77.0 2.5e-78 289.3
Cmo20g00615 CST 1 204 SNARE and Associated Proteins AT5G08080 58.8 1.6e-53 206.8
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.8e-81 299.3
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.4e-80 297.0
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 3.3e-74 275.8
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT4G17730 61.7 7.3e-74 274.6
Cmo16g01226 CST 65 256 SNARE and Associated Proteins AT1G32270 60.9 5.5e-53 205.7
Cmo06g00644 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.3e-51 201.1
Cmo04g01191 CST 25 358 SNARE and Associated Proteins AT5G05760 66.3 6.0e-113 404.8
Cmo04g00161 CST 1 334 SNARE and Associated Proteins AT5G05760 61.5 7.4e-103 371.3
Cmo12g00252 . 443 752 SNARE and Associated Proteins AT3G24350 63.3 1.4e-91 334.0
Cmo05g00672 . 51 348 SNARE and Associated Proteins AT3G24350 62.0 8.8e-86 314.7
Cmo12g01056 CST 1 327 SNARE and Associated Proteins AT5G26980 75.2 1.0e-125 447.2
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT5G26980 66.5 4.2e-103 372.1
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT5G26980 74.6 3.4e-97 352.4
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT4G02195 65.0 2.7e-102 369.4
Cmo12g01056 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.5e-102 369.0
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT4G02195 62.5 3.8e-80 295.8
Cmo12g01056 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.6e-126 449.9
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT3G05710 64.3 2.6e-100 362.8
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT3G05710 72.9 1.9e-98 356.7
Cmo01g01156 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.4e-91 332.0
Cmo09g00974 CCT,CST 3 212 SNARE and Associated Proteins AT1G16240 68.9 5.3e-76 281.6
Cmo16g00959 CCT 38 259 SNARE and Associated Proteins AT1G16240 57.1 1.6e-64 243.4
Cmo01g01156 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.9e-90 329.7
Cmo09g00974 CCT,CST 2 212 SNARE and Associated Proteins AT1G79590 70.0 4.6e-76 282.0
Cmo16g00959 CCT 37 259 SNARE and Associated Proteins AT1G79590 57.5 7.4e-66 248.1
Cmo01g00984 . 5 199 SNARE and Associated Proteins AT1G28490 69.7 1.9e-66 249.6
Cmo17g00043 . 127 314 SNARE and Associated Proteins AT1G28490 53.2 8.5e-38 154.5
Cmo01g01094 . 1 263 SNARE and Associated Proteins AT3G09740 77.4 1.4e-109 393.3
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G09740 76.8 1.2e-108 390.2
Cmo02g00885 CST 1 264 SNARE and Associated Proteins AT3G09740 67.5 6.5e-94 341.3
Cmo01g01094 . 1 263 SNARE and Associated Proteins AT3G45280 63.5 1.7e-86 316.6
Cmo02g00885 CST 1 264 SNARE and Associated Proteins AT3G45280 63.8 6.5e-86 314.7
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G45280 62.9 3.2e-85 312.4
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 1.2e-95 347.1
Cmo01g01094 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 7.5e-95 344.4
Cmo02g00885 CST 1 261 SNARE and Associated Proteins AT3G61450 60.5 3.0e-83 305.8
Cmo04g03046 CST 65 309 SNARE and Associated Proteins AT1G51740 74.4 6.0e-94 341.3
Cmo15g00129 CST 65 284 SNARE and Associated Proteins AT1G51740 61.5 5.9e-65 245.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0005716 1 1 1 2 2 1 2 1 1 1 1 1 2 1 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 1 37
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cmo13g00695 Cmo_Chr13 FPKM 1.11171 0.961912 0.160644 0.232895 1.064049 0.921712 1.111163 1.382388 1.132502 1.173762