Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cmo14g01110 ATGTGCTCGACAGAGGAGGCAGCAGTTGATCTTCAACGGAGGATGCATTTACTTTATCATCTATCAGACGATTCCTTTGAGATCCCTCGGGGTCAGCCTTCTAGAGGAGGAGACATTGAGCTTGGAACAAATGCTCCTACAAGTGCAGGAGATCTGGGCTTGGATGATTTCTTTAAAAAGGTCCAAGATATTGAAAAACAGAATGAGAAGCTGGACAGGTTATTGCGAAAGCTCCAGGATTCACACGAGGAGTCCAAAGCTGTGACTAAAGCTCCAGCAATGAAAGCAATCAAGCAGCGAATGGAAAAGGATGTTGATGAAGTTGGAAAAGTTGCACGTTTTGTGAAGAGCAAGGTCGAAGAACTTGACAAGGAGAATCTGGCAAATAGGCAGAAGCCTGGATGTGGTAAAGGATCAGGTGTAGATAGATCAAGAACAGCAACTACTCTTTCCTTAAAAAAGAAGTTGAAAGACAAGATGACTGAGTTCCAGATTTTGCGGGAAAAAGTTCATCAAGAGTATCGGGAGGTTGTTGAGAGACGGGTTTTCACAGTCACGGGCACTAGGGCTGACGAAGAGACCATCGAGAAATTAATCGAAACTGGGGATAGCGAACAAATTTTTCAGAAGGCAATTCAAGAACAAGGGCGAGGACAGGTAATGGACACTCTAGCTGAAATTCAAGAGCGTCACAGCGCAGTTAGAGAACTGGAGAGGAAGTTACTCGAGCTACAGCAGGTATTTCTGGACATGGCTGTTTTGGTAGATGCACAGGGGGATATGCTCGACAATATCGAATCACATGTTACAAGTGCAGTAGATCATGTGCAACAAGGGAACACTGCACTTCAAAAGGCAAAGAAGCTTCAAAAGAATTCAAGGAAATGGATGTGCATTGCCATAATAATCCTTCTAATCATTGTTGTGGTGGTAGTAGTGGGAGTCCTAAAGCCATGGAATAGTGGTAAGGGTGCGTAA 978 44.07 MCSTEEAAVDLQRRMHLLYHLSDDSFEIPRGQPSRGGDIELGTNAPTSAGDLGLDDFFKKVQDIEKQNEKLDRLLRKLQDSHEESKAVTKAPAMKAIKQRMEKDVDEVGKVARFVKSKVEELDKENLANRQKPGCGKGSGVDRSRTATTLSLKKKLKDKMTEFQILREKVHQEYREVVERRVFTVTGTRADEETIEKLIETGDSEQIFQKAIQEQGRGQVMDTLAEIQERHSAVRELERKLLELQQVFLDMAVLVDAQGDMLDNIESHVTSAVDHVQQGNTALQKAKKLQKNSRKWMCIAIIILLIIVVVVVVGVLKPWNSGKGA 325
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
14 7488054 7497089 + CmoCh14G011100.1 Cmo14g01110 396376

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cmo14g01110 325 Gene3D - 51 178 - -
Cmo14g01110 325 CDD SynN 54 211 IPR006011 GO:0016020
Cmo14g01110 325 SMART tSNARE_6 219 286 IPR000727 -
Cmo14g01110 325 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 224 286 IPR000727 -
Cmo14g01110 325 SUPERFAMILY t-snare proteins 52 279 IPR010989 GO:0016020|GO:0016192
Cmo14g01110 325 Coils Coil 227 247 - -
Cmo14g01110 325 CDD SNARE_syntaxin1-like 223 285 - -
Cmo14g01110 325 SMART SynN_4 49 175 IPR006011 GO:0016020
Cmo14g01110 325 Coils Coil 54 88 - -
Cmo14g01110 325 PANTHER SYNTAXIN 24 316 IPR045242 -
Cmo14g01110 325 Pfam SNARE domain 260 312 IPR000727 -
Cmo14g01110 325 PANTHER - 24 316 - -
Cmo14g01110 325 Pfam Syntaxin 56 259 IPR006011 GO:0016020
Cmo14g01110 325 ProSitePatterns Syntaxin / epimorphin family signature. 230 269 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cmo14g01110 325 Gene3D - 214 317 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmo14g01110 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101203075 509.99
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmo02g00163 Cmo-Chr2:782007 Cmo14g01110 Cmo-Chr14:7488054 1.88E-65 dispersed
Cmo14g01110 Cmo-Chr14:7488054 Cmo18g00322 Cmo-Chr18:2085688 1.65E-90 dispersed
Cmo14g01110 Cmo-Chr14:7488054 Cmo20g00615 Cmo-Chr20:3011939 3.06E-114 transposed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmo12g00252 . 443 752 SNARE and Associated Proteins AT3G24350 63.3 1.4e-91 334.0
Cmo05g00672 . 51 348 SNARE and Associated Proteins AT3G24350 62.0 8.8e-86 314.7
Cmo07g01220 CST 1 308 SNARE and Associated Proteins AT1G08560 68.4 1.7e-101 366.7
Cmo03g00262 CST 1 312 SNARE and Associated Proteins AT1G08560 67.7 3.6e-96 349.0
Cmo03g00768 . 387 687 SNARE and Associated Proteins AT2G18260 53.1 2.9e-82 302.8
Cmo14g00363 . 1344 1604 SNARE and Associated Proteins AT3G11820 81.6 2.5e-116 416.0
Cmo06g00530 . 19 279 SNARE and Associated Proteins AT3G11820 77.4 9.0e-111 397.5
Cmo07g00850 . 21 280 SNARE and Associated Proteins AT3G11820 69.6 1.6e-99 360.1
Cmo18g00322 . 31 281 SNARE and Associated Proteins AT3G11820 67.3 2.6e-94 342.8
Cmo13g00695 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 2.1e-91 333.2
Cmo14g01110 . 44 302 SNARE and Associated Proteins AT3G11820 52.1 6.5e-69 258.5
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT3G52400 64.3 7.0e-93 338.2
Cmo06g00530 . 1 279 SNARE and Associated Proteins AT3G52400 61.5 6.8e-88 321.6
Cmo07g00850 . 1 280 SNARE and Associated Proteins AT3G52400 58.8 4.1e-85 312.4
Cmo13g00695 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.1e-81 300.1
Cmo18g00322 . 1 281 SNARE and Associated Proteins AT3G52400 55.3 1.5e-79 293.9
Cmo14g01110 . 54 302 SNARE and Associated Proteins AT3G52400 50.2 4.6e-60 229.2
Cmo18g00322 . 1 295 SNARE and Associated Proteins AT4G03330 69.8 1.0e-106 384.0
Cmo13g00695 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.3e-106 383.6
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT4G03330 57.5 2.2e-82 303.1
Cmo06g00530 . 1 284 SNARE and Associated Proteins AT4G03330 56.6 1.1e-81 300.8
Cmo07g00850 . 1 278 SNARE and Associated Proteins AT4G03330 52.8 3.5e-75 279.3
Cmo14g01110 . 54 302 SNARE and Associated Proteins AT4G03330 55.4 1.8e-68 256.9
Cmo18g00322 . 1 303 SNARE and Associated Proteins AT1G61290 78.5 6.0e-128 454.5
Cmo13g00695 . 1 303 SNARE and Associated Proteins AT1G61290 77.2 7.3e-126 447.6
Cmo06g00530 . 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.6e-91 332.8
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT1G61290 61.9 5.0e-90 328.6
Cmo07g00850 . 1 292 SNARE and Associated Proteins AT1G61290 54.9 1.4e-81 300.4
Cmo14g01110 . 52 302 SNARE and Associated Proteins AT1G61290 51.0 4.7e-64 242.3
Cmo18g00322 . 1 303 SNARE and Associated Proteins AT1G11250 78.2 3.2e-126 448.7
Cmo13g00695 . 1 303 SNARE and Associated Proteins AT1G11250 76.6 4.4e-123 438.3
Cmo06g00530 . 1 294 SNARE and Associated Proteins AT1G11250 60.2 7.3e-94 341.3
Cmo14g00363 . 1326 1604 SNARE and Associated Proteins AT1G11250 62.7 2.8e-93 339.3
Cmo07g00850 . 1 292 SNARE and Associated Proteins AT1G11250 54.5 7.5e-83 304.7
Cmo14g01110 . 37 302 SNARE and Associated Proteins AT1G11250 51.1 8.9e-68 254.6
Cmo14g01110 . 21 325 SNARE and Associated Proteins AT3G03800 73.1 1.7e-114 409.8
Cmo20g00615 CST 1 305 SNARE and Associated Proteins AT3G03800 55.7 5.0e-82 302.0
Cmo14g01110 . 21 220 SNARE and Associated Proteins AT5G08080 77.0 2.5e-78 289.3
Cmo20g00615 CST 1 204 SNARE and Associated Proteins AT5G08080 58.8 1.6e-53 206.8
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT5G16830 59.9 1.1e-75 280.8
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.8e-81 299.3
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.4e-80 297.0
Cmo06g00644 CST 1 256 SNARE and Associated Proteins AT4G17730 61.3 3.3e-74 275.8
Cmo16g01226 CST 1 256 SNARE and Associated Proteins AT4G17730 61.7 7.3e-74 274.6
Cmo16g01226 CST 65 256 SNARE and Associated Proteins AT1G32270 60.9 5.5e-53 205.7
Cmo06g00644 CST 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.3e-51 201.1
Cmo04g01191 CST 25 358 SNARE and Associated Proteins AT5G05760 66.3 6.0e-113 404.8
Cmo04g00161 CST 1 334 SNARE and Associated Proteins AT5G05760 61.5 7.4e-103 371.3
Cmo12g00252 . 443 752 SNARE and Associated Proteins AT3G24350 63.3 1.4e-91 334.0
Cmo05g00672 . 51 348 SNARE and Associated Proteins AT3G24350 62.0 8.8e-86 314.7
Cmo12g01056 CST 1 327 SNARE and Associated Proteins AT5G26980 75.2 1.0e-125 447.2
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT5G26980 66.5 4.2e-103 372.1
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT5G26980 74.6 3.4e-97 352.4
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT4G02195 65.0 2.7e-102 369.4
Cmo12g01056 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.5e-102 369.0
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT4G02195 62.5 3.8e-80 295.8
Cmo12g01056 CST 1 328 SNARE and Associated Proteins AT3G05710 73.9 1.6e-126 449.9
Cmo17g01031 . 1 320 SNARE and Associated Proteins AT3G05710 64.3 2.6e-100 362.8
Cmo05g01102 CST 1 268 SNARE and Associated Proteins AT3G05710 72.9 1.9e-98 356.7
Cmo01g01156 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.4 3.4e-91 332.0
Cmo09g00974 CCT,CST 3 212 SNARE and Associated Proteins AT1G16240 68.9 5.3e-76 281.6
Cmo16g00959 CCT 38 259 SNARE and Associated Proteins AT1G16240 57.1 1.6e-64 243.4
Cmo01g01156 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.0 1.9e-90 329.7
Cmo09g00974 CCT,CST 2 212 SNARE and Associated Proteins AT1G79590 70.0 4.6e-76 282.0
Cmo16g00959 CCT 37 259 SNARE and Associated Proteins AT1G79590 57.5 7.4e-66 248.1
Cmo01g00984 . 5 199 SNARE and Associated Proteins AT1G28490 69.7 1.9e-66 249.6
Cmo17g00043 . 127 314 SNARE and Associated Proteins AT1G28490 53.2 8.5e-38 154.5
Cmo01g01094 . 1 263 SNARE and Associated Proteins AT3G09740 77.4 1.4e-109 393.3
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G09740 76.8 1.2e-108 390.2
Cmo02g00885 CST 1 264 SNARE and Associated Proteins AT3G09740 67.5 6.5e-94 341.3
Cmo01g01094 . 1 263 SNARE and Associated Proteins AT3G45280 63.5 1.7e-86 316.6
Cmo02g00885 CST 1 264 SNARE and Associated Proteins AT3G45280 63.8 6.5e-86 314.7
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G45280 62.9 3.2e-85 312.4
Cmo14g00195 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 1.2e-95 347.1
Cmo01g01094 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 7.5e-95 344.4
Cmo02g00885 CST 1 261 SNARE and Associated Proteins AT3G61450 60.5 3.0e-83 305.8
Cmo04g03046 CST 65 309 SNARE and Associated Proteins AT1G51740 74.4 6.0e-94 341.3
Cmo15g00129 CST 65 284 SNARE and Associated Proteins AT1G51740 61.5 5.9e-65 245.0
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001189 1 6 1 1 1 2 3 2 2 2 2 2 3 2 3 3 2 4 3 2 3 1 2 3 3 2 3 8 3 2 77
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cmo14g01110 Cmo_Chr14 FPKM 1.340588 0.919663 2.532195 2.737135 10.794281 10.661317 11.267976 3.417687 2.933148 3.475385