Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cmo15g00609 ATGGCTGCAACTTCTGGTGCTGTGCTTAATGGGTTGGGCTCACCCTTCCTCCATGGCGGAAGCAGAACTCAGACCTTGCTGGCTGGAGCCAGAGGCGGTGTCAATGTCGTTGGCTCTCGCAAGCTTGTCATCGTCGCCGCTGCTCAGCCCAAGAAGTCTTGGATCCCTGCTGTTAAGGGCGGAGGCAACTTAGTCGACCCAGAATGGCTAGATGGCTCACTTCCAGGTGACTTCGGCTTCGACCCATTAGGGTTGGGGAAGGACCCTGCATTTCTGAAATGGTACAGAGAGGCAGAGCTGATCCACGGCCGGTGGGCAATGGCAGCGGTGGTCGGAATCTTCGTAGGCCAAGCCTGGAGTGGGATCCCATGGTTCGAAGCCGGAGCCGATCCAGGCGCAATTGCTCCATTCTCCTTCGGATCACTTCTCGGAACCCAGCTTCTACTAATGGGATGGGTGGAGAGCAAGCGGTGGGTGGATTTCTTCAACCCAGAGTCTCAATCGGTGGAATGGGCGACGCCATGGTCGAGGACGGCAGAGAACTTCGCAAACGCAACGGGAGAACAGGGTTATCCCGGCGGAAAATTCTTCGATCCGTTGGGATTTGCCGGAACTATTAAAGATGGGGTTTACATTCCGGACACGGACAAATTGGAGAGATTGAAGTTGGCTGAGATCAAGCATGCTAGGATCGCCATGTTAGCGATGCTCATCTTCTACTTTGAAGCTGGACAGGGGAAGACGCCATTGGGGGCTCTTGGAGTATAA 768 54.95 MAATSGAVLNGLGSPFLHGGSRTQTLLAGARGGVNVVGSRKLVIVAAAQPKKSWIPAVKGGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLGFAGTIKDGVYIPDTDKLERLKLAEIKHARIAMLAMLIFYFEAGQGKTPLGALGV 255
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
15 2958942 2960043 - CmoCh15G006090.1 Cmo15g00609 398117

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cmo15g00609 255 Gene3D Chlorophyll a/b binding protein domain 67 254 - -
Cmo15g00609 255 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 2 255 IPR001344 GO:0009765|GO:0016020
Cmo15g00609 255 Pfam Chlorophyll A-B binding protein 67 243 IPR022796 -
Cmo15g00609 255 PANTHER CHLOROPHYLL A-B BINDING PROTEIN, CHLOROPLASTIC 2 255 - -
Cmo15g00609 255 SUPERFAMILY Chlorophyll a-b binding protein 59 254 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmo15g00609 K08917 LHCB6; light-harvesting complex II chlorophyll a/b binding protein 6 - csv:101204705 500.36
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmo11g01491 Cmo-Chr11:10562285 Cmo15g00609 Cmo-Chr15:2958942 8.82E-180 dispersed
Cmo15g00609 Cmo-Chr15:2958942 Cmo11g00756 Cmo-Chr11:3676214 1.94E-37 dispersed
Cmo15g00609 Cmo-Chr15:2958942 Cmo04g01932 Cmo-Chr4:9872268 2.16E-34 transposed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmo01g00616 . 157 488 Chloroplast and Mitochondria Gene Families AT2G28800 73.0 1.3e-128 457.2
Cmo05g00063 . 71 410 Chloroplast and Mitochondria Gene Families AT2G28800 57.1 7.5e-100 361.7
Cmo12g00034 . 71 423 Chloroplast and Mitochondria Gene Families AT2G28800 53.5 2.5e-95 346.7
Cmo11g01491 . 6 258 Chloroplast and Mitochondria Gene Families AT1G15820 82.0 3.0e-120 428.7
Cmo15g00609 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 3.9e-120 428.3
Cmo11g01832 . 98 346 Chloroplast and Mitochondria Gene Families AT3G27690 88.0 5.1e-132 468.0
Cmo19g00879 . 952 1168 Chloroplast and Mitochondria Gene Families AT3G27690 93.1 3.0e-124 442.2
Cmo01g00276 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 7.7e-120 427.6
Cmo13g00573 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 1.7e-119 426.4
Cmo03g01376 CST 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.9e-119 425.6
Cmo20g00287 CST 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 76.6 3.8e-119 425.2
Cmo07g00130 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 3.8e-119 425.2
Cmo07g00129 CST 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 5.0e-119 424.9
Cmo02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT3G27690 76.2 6.5e-119 424.5
Cmo14g00978 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.5 6.1e-117 417.9
Cmo04g00986 . 5 269 Chloroplast and Mitochondria Gene Families AT3G27690 66.9 1.1e-97 354.0
Cmo16g00863 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 66.4 4.1e-97 352.1
Cmo09g00013 . 113 329 Chloroplast and Mitochondria Gene Families AT3G27690 51.6 3.6e-53 206.1
Cmo01g00935 . 73 276 Chloroplast and Mitochondria Gene Families AT3G27690 52.2 2.4e-52 203.4
Cmo09g01192 . 222 425 Chloroplast and Mitochondria Gene Families AT3G27690 50.7 9.9e-51 198.0
Cmo04g01932 . 3 262 Chloroplast and Mitochondria Gene Families AT3G61470 81.7 4.0e-125 444.9
Cmo18g00628 . 27 240 Chloroplast and Mitochondria Gene Families AT3G61470 77.8 5.8e-108 387.9
Cmo11g00756 . 61 266 Chloroplast and Mitochondria Gene Families AT3G61470 65.5 5.3e-85 311.6
Cmo10g00213 CST 22 250 Chloroplast and Mitochondria Gene Families AT3G61470 50.6 1.2e-63 240.7
Cmo01g00834 . 288 511 Chloroplast and Mitochondria Gene Families AT3G61470 50.6 1.4e-61 233.8
Cmo15g00458 CST 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 5.0e-89 324.7
Cmo04g02705 CST 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 80.4 4.3e-88 321.6
Cmo07g01093 . 1 286 Chloroplast and Mitochondria Gene Families AT3G08940 82.0 4.5e-133 471.5
Cmo03g00375 . 54 210 Chloroplast and Mitochondria Gene Families AT3G08940 77.2 7.6e-64 241.5
Cmo09g00013 . 3 336 Chloroplast and Mitochondria Gene Families AT1G76570 71.3 2.8e-139 492.3
Cmo19g00879 . 951 1159 Chloroplast and Mitochondria Gene Families AT1G76570 50.2 6.8e-53 205.3
Cmo11g01832 . 148 346 Chloroplast and Mitochondria Gene Families AT1G76570 50.2 1.6e-49 194.1
Cmo10g00908 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 85.7 1.6e-135 479.6
Cmo11g00916 . 1 261 Chloroplast and Mitochondria Gene Families AT1G61520 82.5 3.9e-126 448.4
Cmo11g01832 . 102 346 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 6.0e-132 467.6
Cmo19g00879 . 952 1168 Chloroplast and Mitochondria Gene Families AT2G05070 92.2 1.9e-122 436.0
Cmo13g00573 . 7 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.8 3.1e-120 428.7
Cmo03g01376 CST 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 9.0e-120 427.2
Cmo20g00287 CST 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 1.5e-119 426.4
Cmo07g00130 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.2 4.4e-119 424.9
Cmo07g00129 CST 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 5.8e-119 424.5
Cmo02g00036 CST 8 269 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 2.9e-118 422.2
Cmo01g00276 . 8 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.8 3.8e-118 421.8
Cmo14g00978 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.2 2.1e-116 416.0
Cmo04g00986 . 8 269 Chloroplast and Mitochondria Gene Families AT2G05070 67.5 3.7e-97 352.1
Cmo16g00863 . 8 264 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 6.2e-97 351.3
Cmo01g00935 . 73 276 Chloroplast and Mitochondria Gene Families AT2G05070 52.6 1.6e-52 203.8
Cmo09g00013 . 113 329 Chloroplast and Mitochondria Gene Families AT2G05070 51.2 1.0e-51 201.1
Cmo11g01832 . 102 338 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.7e-125 446.4
Cmo19g00879 . 952 1140 Chloroplast and Mitochondria Gene Families AT2G05100 91.5 7.0e-103 371.3
Cmo13g00573 . 7 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.7 1.7e-101 366.7
Cmo03g01376 CST 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 2.9e-101 365.9
Cmo07g00129 CST 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 1.5e-100 363.6
Cmo01g00276 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 3.2e-100 362.5
Cmo20g00287 CST 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 4.2e-100 362.1
Cmo07g00130 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.9 4.2e-100 362.1
Cmo02g00036 CST 8 241 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 9.4e-100 360.9
Cmo14g00978 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 75.4 2.3e-98 356.3
Cmo04g00986 . 8 241 Chloroplast and Mitochondria Gene Families AT2G05100 67.5 2.3e-82 303.1
Cmo16g00863 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.2 5.2e-82 302.0
Cmo01g00935 . 73 260 Chloroplast and Mitochondria Gene Families AT2G05100 50.8 1.6e-43 174.1
Cmo07g01093 . 4 168 Chloroplast and Mitochondria Gene Families AT2G40100 71.0 9.8e-65 243.8
Cmo03g00375 . 53 212 Chloroplast and Mitochondria Gene Families AT2G40100 71.3 1.3e-61 233.4
Cmo20g00287 CST 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 1.5e-135 479.6
Cmo13g00573 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 7.6e-135 477.2
Cmo02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 1.7e-134 476.1
Cmo03g01376 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 8.4e-134 473.8
Cmo07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 1.1e-133 473.4
Cmo07g00130 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 86.9 1.4e-133 473.0
Cmo01g00276 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 85.3 1.7e-126 449.5
Cmo14g00978 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 83.1 7.1e-125 444.1
Cmo19g00879 . 952 1168 Chloroplast and Mitochondria Gene Families AT1G29930 86.7 3.7e-113 405.2
Cmo11g01832 . 104 346 Chloroplast and Mitochondria Gene Families AT1G29930 77.7 6.9e-104 374.4
Cmo16g00863 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29930 74.5 1.9e-93 339.7
Cmo04g00986 . 51 269 Chloroplast and Mitochondria Gene Families AT1G29930 74.5 1.9e-93 339.7
Cmo01g00935 . 73 276 Chloroplast and Mitochondria Gene Families AT1G29930 51.4 1.2e-52 204.1
Cmo09g01192 . 222 425 Chloroplast and Mitochondria Gene Families AT1G29930 50.5 1.1e-51 201.1
Cmo20g00287 CST 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 5.8e-135 477.6
Cmo03g01376 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.6 1.7e-134 476.1
Cmo13g00573 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 2.9e-134 475.3
Cmo02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 6.4e-134 474.2
Cmo07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 4.2e-133 471.5
Cmo07g00130 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.5 5.5e-133 471.1
Cmo01g00276 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 85.3 2.2e-126 449.1
Cmo14g00978 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 83.1 9.3e-125 443.7
Cmo19g00879 . 952 1168 Chloroplast and Mitochondria Gene Families AT1G29920 86.7 3.7e-113 405.2
Cmo11g01832 . 132 346 Chloroplast and Mitochondria Gene Families AT1G29920 83.6 9.1e-104 374.0
Cmo16g00863 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29920 74.5 1.9e-93 339.7
Cmo04g00986 . 51 269 Chloroplast and Mitochondria Gene Families AT1G29920 74.5 1.9e-93 339.7
Cmo01g00935 . 73 276 Chloroplast and Mitochondria Gene Families AT1G29920 51.4 1.2e-52 204.1
Cmo09g01192 . 222 425 Chloroplast and Mitochondria Gene Families AT1G29920 50.5 1.1e-51 201.1
Cmo20g00287 CST 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 5.8e-135 477.6
Cmo03g01376 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.6 1.7e-134 476.1
Cmo13g00573 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 2.9e-134 475.3
Cmo02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 6.4e-134 474.2
Cmo07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 4.2e-133 471.5
Cmo07g00130 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.5 5.5e-133 471.1
Cmo01g00276 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 85.3 2.2e-126 449.1
Cmo14g00978 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 83.1 9.3e-125 443.7
Cmo19g00879 . 952 1168 Chloroplast and Mitochondria Gene Families AT1G29910 86.7 3.7e-113 405.2
Cmo11g01832 . 132 346 Chloroplast and Mitochondria Gene Families AT1G29910 83.6 9.1e-104 374.0
Cmo16g00863 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29910 74.5 1.9e-93 339.7
Cmo04g00986 . 51 269 Chloroplast and Mitochondria Gene Families AT1G29910 74.5 1.9e-93 339.7
Cmo01g00935 . 73 276 Chloroplast and Mitochondria Gene Families AT1G29910 51.4 1.2e-52 204.1
Cmo09g01192 . 222 425 Chloroplast and Mitochondria Gene Families AT1G29910 50.5 1.1e-51 201.1
Cmo01g00935 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 82.6 1.3e-132 469.9
Cmo09g01192 . 163 440 Chloroplast and Mitochondria Gene Families AT4G10340 83.2 1.3e-132 469.9
Cmo13g00573 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.4 3.0e-57 219.5
Cmo03g01376 CST 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 8.7e-57 218.0
Cmo07g00130 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 1.1e-56 217.6
Cmo07g00129 CST 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 1.1e-56 217.6
Cmo14g00978 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.6
Cmo02g00036 CST 53 257 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.5e-56 217.2
Cmo20g00287 CST 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.5e-56 217.2
Cmo01g00276 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 3.3e-56 216.1
Cmo19g00879 . 952 1156 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 2.6e-53 206.5
Cmo16g00863 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 5.0e-52 202.2
Cmo04g00986 . 51 257 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 5.0e-52 202.2
Cmo11g01832 . 150 346 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 4.2e-51 199.1
Cmo20g00287 CST 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.1 9.9e-135 476.9
Cmo02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT2G34420 88.1 1.1e-133 473.4
Cmo03g01376 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 5.4e-133 471.1
Cmo07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 7.1e-133 470.7
Cmo07g00130 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.9 9.2e-133 470.3
Cmo13g00573 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.5 4.6e-132 468.0
Cmo01g00276 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.0 2.6e-127 452.2
Cmo14g00978 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 83.5 1.4e-125 446.4
Cmo19g00879 . 952 1168 Chloroplast and Mitochondria Gene Families AT2G34420 86.7 1.1e-112 403.7
Cmo11g01832 . 104 346 Chloroplast and Mitochondria Gene Families AT2G34420 76.1 3.1e-104 375.6
Cmo16g00863 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34420 75.0 2.5e-93 339.3
Cmo04g00986 . 51 269 Chloroplast and Mitochondria Gene Families AT2G34420 75.0 2.5e-93 339.3
Cmo01g00935 . 73 276 Chloroplast and Mitochondria Gene Families AT2G34420 50.5 6.1e-52 201.8
Cmo03g01376 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 4.4e-135 478.0
Cmo20g00287 CST 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 87.3 9.9e-135 476.9
Cmo13g00573 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.8 1.3e-134 476.5
Cmo07g00129 CST 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.3e-134 476.5
Cmo07g00130 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 1.7e-134 476.1
Cmo02g00036 CST 3 269 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 1.9e-133 472.6
Cmo01g00276 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.0 3.6e-129 458.4
Cmo14g00978 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.8 2.0e-127 452.6
Cmo19g00879 . 952 1168 Chloroplast and Mitochondria Gene Families AT2G34430 86.7 1.4e-112 403.3
Cmo11g01832 . 131 346 Chloroplast and Mitochondria Gene Families AT2G34430 83.1 4.5e-103 371.7
Cmo04g00986 . 34 269 Chloroplast and Mitochondria Gene Families AT2G34430 71.0 1.4e-93 340.1
Cmo16g00863 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34430 75.0 3.2e-93 339.0
Cmo07g01093 . 1 286 Chloroplast and Mitochondria Gene Families AT5G01530 81.0 9.1e-134 473.8
Cmo03g00375 . 56 210 Chloroplast and Mitochondria Gene Families AT5G01530 75.6 4.5e-64 242.3
Cmo04g00920 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 8.7e-144 506.9
Cmo16g00800 . 48 348 Chloroplast and Mitochondria Gene Families AT5G40810 81.4 2.5e-138 488.8
Cmo04g00920 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.8 1.4e-148 523.1
Cmo16g00800 . 1 348 Chloroplast and Mitochondria Gene Families AT3G27240 75.5 1.0e-143 506.9
Cmo20g00352 CST 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 74.4 4.0e-141 498.4
Cmo02g00725 CST 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 73.8 4.4e-140 495.0
Cmo03g00342 CST 3 303 Chloroplast and Mitochondria Gene Families AT2G30160 65.4 5.6e-111 398.3
Cmo07g01125 CST 9 306 Chloroplast and Mitochondria Gene Families AT2G30160 66.7 7.3e-111 397.9
Cmo20g00352 CST 1 327 Chloroplast and Mitochondria Gene Families AT1G07030 74.4 9.6e-140 493.8
Cmo02g00725 CST 5 327 Chloroplast and Mitochondria Gene Families AT1G07030 74.5 2.1e-139 492.7
Cmo03g00342 CST 3 303 Chloroplast and Mitochondria Gene Families AT1G07030 68.6 5.1e-117 418.3
Cmo07g01125 CST 5 303 Chloroplast and Mitochondria Gene Families AT1G07030 68.1 2.0e-113 406.4
Cmo08g00433 CST 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 75.4 2.2e-133 472.6
Cmo15g00963 . 86 387 Chloroplast and Mitochondria Gene Families AT2G47490 63.0 3.8e-109 392.1
Cmo17g01033 CST 1 309 Chloroplast and Mitochondria Gene Families AT2G47490 63.2 1.8e-103 373.2
Cmo15g00963 . 78 438 Chloroplast and Mitochondria Gene Families AT1G25380 62.4 1.4e-123 440.3
Cmo08g00433 CST 11 296 Chloroplast and Mitochondria Gene Families AT1G25380 64.4 5.0e-105 378.6
Cmo17g01033 CST 11 292 Chloroplast and Mitochondria Gene Families AT1G25380 53.6 9.8e-77 284.6
Cmo13g00698 . 1018 1572 Chloroplast and Mitochondria Gene Families AT4G21490 73.4 2.6e-241 832.0
Cmo02g00128 CCT 5 588 Chloroplast and Mitochondria Gene Families AT4G21490 67.7 1.8e-234 809.3
Cmo19g00997 CCT 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.4 9.4e-223 770.4
Cmo17g00685 . 15 186 Chloroplast and Mitochondria Gene Families AT1G17530 67.6 1.7e-61 233.0
Cmo08g00750 CCT 4 168 Chloroplast and Mitochondria Gene Families AT1G17530 67.3 7.5e-57 217.6
Cmo10g01063 . 5 180 Chloroplast and Mitochondria Gene Families AT1G17530 57.3 1.8e-50 196.4
Cmo11g01005 . 10 179 Chloroplast and Mitochondria Gene Families AT1G17530 55.8 7.7e-46 181.0
Cmo10g01063 . 15 184 Chloroplast and Mitochondria Gene Families AT3G04800 59.1 1.1e-50 197.2
Cmo11g01005 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 53.8 6.1e-46 181.4
Cmo17g00685 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 6.3e-43 171.4
Cmo08g00750 CCT 22 168 Chloroplast and Mitochondria Gene Families AT3G04800 55.7 1.8e-37 153.3
Cmo17g00685 . 5 190 Chloroplast and Mitochondria Gene Families AT1G72750 65.8 1.9e-63 239.6
Cmo08g00750 CCT 15 168 Chloroplast and Mitochondria Gene Families AT1G72750 70.4 1.9e-55 213.0
Cmo10g01063 . 5 184 Chloroplast and Mitochondria Gene Families AT1G72750 59.0 1.1e-52 203.8
Cmo11g01005 . 10 183 Chloroplast and Mitochondria Gene Families AT1G72750 54.8 3.2e-47 185.7
Cmo18g01070 . 57 296 Chloroplast and Mitochondria Gene Families AT1G26100 57.9 2.4e-71 266.2
Cmo04g02972 CST 34 259 Chloroplast and Mitochondria Gene Families AT5G38630 70.5 3.8e-90 328.6
Cmo15g00206 CST 1 269 Chloroplast and Mitochondria Gene Families AT5G38630 57.4 1.2e-80 297.0
Cmo19g00423 . 23 221 Chloroplast and Mitochondria Gene Families AT4G25570 73.4 5.4e-83 305.1
Cmo02g01080 . 23 225 Chloroplast and Mitochondria Gene Families AT4G25570 65.5 4.6e-74 275.4
Cmo04g02319 CCT,ECH 9 364 Chloroplast and Mitochondria Gene Families AT5G14040 81.8 2.1e-170 595.9
Cmo15g00842 . 9 363 Chloroplast and Mitochondria Gene Families AT5G14040 80.3 7.3e-168 587.4
Cmo11g01578 CCT,ECH 9 365 Chloroplast and Mitochondria Gene Families AT5G14040 77.3 1.3e-161 566.6
Cmo10g00024 CST 39 347 Chloroplast and Mitochondria Gene Families AT5G14040 84.6 5.4e-155 544.7
Cmo11g01793 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.4 2.0e-85 313.5
Cmo11g01578 CCT,ECH 11 365 Chloroplast and Mitochondria Gene Families AT3G48850 73.2 1.4e-147 520.0
Cmo04g02319 CCT,ECH 8 363 Chloroplast and Mitochondria Gene Families AT3G48850 71.0 7.6e-146 514.2
Cmo15g00842 . 8 358 Chloroplast and Mitochondria Gene Families AT3G48850 71.1 1.1e-144 510.4
Cmo10g00024 CST 12 347 Chloroplast and Mitochondria Gene Families AT3G48850 69.6 1.5e-141 500.0
Cmo11g01793 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 51.9 4.4e-85 312.4
Cmo11g01793 . 8 305 Chloroplast and Mitochondria Gene Families AT2G17270 72.9 2.0e-126 449.5
Cmo11g01578 CCT,ECH 67 368 Chloroplast and Mitochondria Gene Families AT2G17270 51.8 1.2e-86 317.4
Cmo15g00842 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.6 2.9e-85 312.8
Cmo04g02319 CCT,ECH 62 363 Chloroplast and Mitochondria Gene Families AT2G17270 50.7 1.1e-84 310.8
Cmo10g00024 CST 51 348 Chloroplast and Mitochondria Gene Families AT2G17270 50.2 4.1e-84 308.9
Cmo15g00236 CST 16 319 Chloroplast and Mitochondria Gene Families AT5G15640 76.5 2.7e-131 465.7
Cmo04g02937 CST 16 319 Chloroplast and Mitochondria Gene Families AT5G15640 75.9 2.3e-130 462.6
Cmo09g00356 . 12 344 Chloroplast and Mitochondria Gene Families AT5G26200 66.7 1.0e-123 440.7
Cmo17g00679 . 1 342 Chloroplast and Mitochondria Gene Families AT5G26200 59.3 4.7e-105 378.6
Cmo08g00754 . 1 336 Chloroplast and Mitochondria Gene Families AT5G26200 57.3 6.4e-102 368.2
Cmo17g00679 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 76.8 2.1e-148 522.7
Cmo08g00754 . 1 340 Chloroplast and Mitochondria Gene Families AT1G72820 74.2 1.4e-144 510.0
Cmo09g00356 . 1 345 Chloroplast and Mitochondria Gene Families AT1G72820 69.6 2.1e-129 459.5
Cmo16g00108 CST 97 301 Chloroplast and Mitochondria Gene Families AT5G52570 58.5 1.5e-57 220.3
Cmo15g01313 . 75 289 Chloroplast and Mitochondria Gene Families AT5G52570 50.2 3.9e-50 195.7
Cmo18g01298 CST 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 64.0 3.0e-68 255.8
Cmo16g00108 CST 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 61.5 2.0e-67 253.1
Cmo15g01313 . 35 206 Chloroplast and Mitochondria Gene Families AT4G25700 58.8 7.2e-54 208.0
Cmo16g00863 . 443 711 Chloroplast and Mitochondria Gene Families AT5G54290 83.3 4.9e-121 431.8
Cmo11g00421 . 43 546 Chloroplast and Mitochondria Gene Families AT2G18710 84.5 4.3e-241 831.2
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0004103 4 1 2 3 2 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 2 1 1 1 2 1 0 2 1 1 44
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cmo15g00609 Cmo_Chr15 FPKM 4.051037 1.861353 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0