Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cmu01g1461 ATGAACGATCTGTTTTCCACCGATTCCTTCCGCCGACAGCAGCACCGCCATGACTCCGTCGAGATTCCCGACAACGCGCCGTCGTCAACGACTATCAATCTCAACAGTTTCTTCGACGACGTGGAGTCCGTGAAGGCAGAATTGACGGAGCTCGAACGCCTGTATCGAAGCCTCCAGAATTCTCACGAGCAGAGCAAAACTCTTCACAATTCGAAGGCGATTAAGGATCTTCGATCGCGAATGGAATCGGATGTGACTCTGGCTCTGAAGAAGGCTAGGTTTATCAAGCTCCGGTTGGAGGAACTGGACCGGTCCAATGCCGAGAACCGGAATCTTCCTGGTTGTGGCTATGGCTCCTCCGCCGACCGGTCAAGAACTTCCGTCGTCAATGGATTGAGGAAGAAGCTGTGTGATTCGATGGAGAGTTTCAATAGATTGAGAGAGGAGATTTCGTCGACGTATAAGGAGACGATTGAACGAAGGTATTTCACAATTACAGGGGAAAATCCTGATGAGAAGACGGTTGATTTGTTGATCTCTACAGGCGAAAGCGAAACATTCTTGCAAAAAGCAATACAAAAGCAAGGAAGAGGAAGAGTTTTGGAAACAATCCAAGAGATTCAAGAAAGGCATGACGCAGTGAAAGACATAGAGAGGAATTTGAGAGAGCTGCACCAAGTTTTCATGGACATGGCGGTGCTGGTTCAATCTCAGGGGCAGCACTTGGACGATATCGAGAGCCAAGTGACTCGAGCCAACTCCGCTGTCAAGCGCGGCACCACGGAGCTACAAACTGCAAGATACTACCAGAAAAACACTCGCAAATGGATCTGCATAGGCGTCATCGTTCTCGCACTCATTCTCTTCATCATTATCATCTCCGTCGTCCTTTCCAAGAAGTAG 903 48.84 MNDLFSTDSFRRQQHRHDSVEIPDNAPSSTTINLNSFFDDVESVKAELTELERLYRSLQNSHEQSKTLHNSKAIKDLRSRMESDVTLALKKARFIKLRLEELDRSNAENRNLPGCGYGSSADRSRTSVVNGLRKKLCDSMESFNRLREEISSTYKETIERRYFTITGENPDEKTVDLLISTGESETFLQKAIQKQGRGRVLETIQEIQERHDAVKDIERNLRELHQVFMDMAVLVQSQGQHLDDIESQVTRANSAVKRGTTELQTARYYQKNTRKWICIGVIVLALILFIIIISVVLSKK 300
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
1 28156998 28158554 + CmPI595203_01g014610.1 Cmu01g1461 406967

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cmu01g1461 300 Gene3D - 199 298 - -
Cmu01g1461 300 PANTHER SYNTAXIN 36 287 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cmu01g1461 300 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 31 161 - -
Cmu01g1461 300 Pfam Syntaxin 36 239 IPR006011 GO:0016020(InterPro)
Cmu01g1461 300 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 204 266 IPR000727 -
Cmu01g1461 300 CDD SynN 34 191 IPR006011 GO:0016020(InterPro)
Cmu01g1461 300 ProSitePatterns Syntaxin / epimorphin family signature. 210 249 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cmu01g1461 300 Pfam SNARE domain 242 292 IPR000727 -
Cmu01g1461 300 Coils Coil 34 68 - -
Cmu01g1461 300 MobiDBLite consensus disorder prediction 1 27 - -
Cmu01g1461 300 CDD SNARE_syntaxin1-like 203 265 - -
Cmu01g1461 300 FunFam Syntaxin 132 197 297 - -
Cmu01g1461 300 SMART tSNARE_6 199 266 IPR000727 -
Cmu01g1461 300 SUPERFAMILY t-snare proteins 33 259 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cmu01g1461 300 SMART SynN_4 29 155 IPR006011 GO:0016020(InterPro)
Cmu01g1461 300 Gene3D - 32 164 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmu01g1461 K08486 - - csv:101213199 496.123
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmu01g1461 Cmu-Chr1:28156998 Cmu10g2554 Cmu-Chr10:32279926 1.70E-111 dispersed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmu08g1223 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.1e-84 309.7
Cmu04g0567 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 3.6e-101 365.2
Cmu01g1899 . 431 732 SNARE and Associated Proteins AT2G18260 54.4 9.3e-86 313.9
Cmu10g2554 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.4e-115 411.8
Cmu01g1461 . 26 282 SNARE and Associated Proteins AT3G11820 72.8 8.6e-103 370.5
Cmu03g1156 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.1e-92 337.0
Cmu10g2115 . 95 349 SNARE and Associated Proteins AT3G11820 52.5 4.8e-69 258.5
Cmu10g2554 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.7e-92 334.7
Cmu01g1461 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.3e-85 312.8
Cmu03g1156 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.5e-81 298.9
Cmu10g2115 . 97 349 SNARE and Associated Proteins AT3G52400 50.6 5.2e-61 231.9
Cmu03g1156 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 3.0e-108 388.7
Cmu10g2554 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 1.5e-83 306.6
Cmu01g1461 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 3.8e-79 292.0
Cmu10g2115 . 86 349 SNARE and Associated Proteins AT4G03330 53.8 1.1e-67 253.8
Cmu03g1156 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.8e-128 453.4
Cmu10g2554 . 1 279 SNARE and Associated Proteins AT1G61290 63.1 4.3e-91 331.6
Cmu01g1461 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.6e-85 313.2
Cmu10g2115 . 101 349 SNARE and Associated Proteins AT1G61290 50.6 1.9e-62 236.5
Cmu03g1156 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Cmu10g2554 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 3.4e-93 338.6
Cmu01g1461 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 1.1e-86 317.0
Cmu10g2115 . 85 349 SNARE and Associated Proteins AT1G11250 50.6 4.7e-66 248.4
Cmu10g2115 . 73 368 SNARE and Associated Proteins AT3G03800 74.0 2.9e-111 398.7
Cmu02g0866 . 41 327 SNARE and Associated Proteins AT3G03800 55.6 2.0e-80 296.2
Cmu10g2115 . 73 267 SNARE and Associated Proteins AT5G08080 79.1 1.2e-77 286.6
Cmu02g0866 . 27 227 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Cmu10g0988 . 1 253 SNARE and Associated Proteins AT5G16830 59.5 2.0e-74 276.2
Cmu10g0988 . 1 253 SNARE and Associated Proteins AT5G46860 66.0 9.7e-79 290.4
Cmu10g0988 . 1 242 SNARE and Associated Proteins AT4G17730 63.2 4.5e-73 271.6
Cmu10g0988 . 65 253 SNARE and Associated Proteins AT1G32270 59.8 1.1e-50 197.6
Cmu07g0454 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 3.2e-111 398.7
Cmu08g1223 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.1e-84 309.7
Cmu02g1513 . 35 361 SNARE and Associated Proteins AT5G26980 76.8 4.7e-128 454.5
Cmu09g0526 . 1 318 SNARE and Associated Proteins AT5G26980 66.2 2.6e-102 369.0
Cmu09g0526 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 1.1e-105 380.2
Cmu02g1513 . 35 363 SNARE and Associated Proteins AT4G02195 64.4 3.3e-105 378.6
Cmu02g1513 . 35 362 SNARE and Associated Proteins AT3G05710 76.3 3.9e-130 461.5
Cmu09g0526 . 1 318 SNARE and Associated Proteins AT3G05710 63.7 1.0e-98 357.1
Cmu09g1057 . 91 323 SNARE and Associated Proteins AT1G16240 72.1 2.4e-89 325.5
Cmu10g1294 . 905 1137 SNARE and Associated Proteins AT1G16240 67.8 3.3e-83 305.1
Cmu09g1057 . 90 323 SNARE and Associated Proteins AT1G79590 71.4 3.9e-88 321.6
Cmu10g1294 . 900 1137 SNARE and Associated Proteins AT1G79590 67.2 1.5e-84 309.7
Cmu06g0051 . 114 304 SNARE and Associated Proteins AT1G28490 71.7 8.3e-67 250.4
Cmu10g2760 . 1 264 SNARE and Associated Proteins AT3G09740 79.7 2.7e-113 405.2
Cmu02g2099 . 1 265 SNARE and Associated Proteins AT3G09740 67.8 1.5e-95 346.3
Cmu02g2099 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.6e-92 334.0
Cmu10g2760 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 8.7e-88 320.5
Cmu10g2760 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 7.2e-95 344.0
Cmu02g2099 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 3.0e-85 312.0
Cmu11g0646 . 65 290 SNARE and Associated Proteins AT1G51740 69.3 1.2e-78 290.0
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62