Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cmu02g1834 ATGGCAGCTTCATCAATGGCTCTCTCCTCCCCATCTCTCGCCGGCCAAGCCGTCAAATTATCCCCCACGACCTCCGACCTCCTGGGCGACGGTCGCATCACCATGAGAAAAACTGCCGGAAAGCCCAAGCCCATTTCCTCCGGAAGCCCATGGTACGGCCCAGATCGCGTCAAATACCTAGGCCCATTCTCTGGCGAGCCCCCTTCTTATTTGACTGGAGAATTCCCCGGCGATTACGGCTGGGACACCGCCGGTTTATCCGCCGACCCGGAAACTTTCGCGAAAAACCGTGAGCTGGAAGTGATCCACTCGAGATGGGCCATGCTCGGCGCTCTGGGCTGCGTCTTCCCGGAGCTGCTGTCTCGCAACGGAGTAAAATTCGGCGAAGCCGTGTGGTTCAAAGCTGGGTCTCAAATCTTTAGCGAGGGTGGGCTAGATTATTTGGGGAACCCGAGCCTGGTCCACGCTCAGAGCATTTTAGCCATTTGGGCTTGTCAAGTTGTGCTAATGGGTGCGGTTGAAGGGTATAGAATTGCGGGGGGGCCATTGGGGGAAATTACTGACCCGATTTACCCAGGTGGGAGCTTTGATCCATTGGGGCTTGCTGATGATCCAGAGGCGTTTGCGGAATTGAAAGTGAAGGAACTTAAGAATGGAAGATTGGCTATGTTTTCGATGTTTGGTTTCTTTGTACAGGCGATTGTGACTGGGAAAGGACCTTTGGAGAATTTGGCTGATCATTTGGCCGATCCTGTTAACAATAATGCTTGGGCTTATGCTACTAACTTTGTACCTGGAAAGTGA 804 53.11 MAASSMALSSPSLAGQAVKLSPTTSDLLGDGRITMRKTAGKPKPISSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 267
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
2 32255880 32256683 - CmPI595203_02g018340.1 Cmu02g1834 409883

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cmu02g1834 267 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 4 267 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
Cmu02g1834 267 MobiDBLite consensus disorder prediction 28 50 - -
Cmu02g1834 267 SUPERFAMILY Chlorophyll a-b binding protein 50 264 - -
Cmu02g1834 267 FunFam Chlorophyll a-b binding protein, chloroplastic 58 260 - -
Cmu02g1834 267 Pfam Chlorophyll A-B binding protein 67 234 IPR022796 -
Cmu02g1834 267 Gene3D Chlorophyll a/b binding protein domain 58 260 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmu02g1834 K08912 - - csv:101213845 540.806
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmu01g2380 Cmu-Chr1:35830101 Cmu02g1834 Cmu-Chr2:32255880 3.10E-145 dispersed
Cmu02g0278 Cmu-Chr2:2557272 Cmu02g1834 Cmu-Chr2:32255880 2.90E-120 dispersed
Cmu02g1834 Cmu-Chr2:32255880 Cmu10g1951 Cmu-Chr10:25095395 3.60E-134 dispersed
Cmu08g0181 Cmu-Chr8:3890002 Cmu02g1834 Cmu-Chr2:32255880 6.30E-56 transposed
Cmu11g1896 Cmu-Chr11:30955298 Cmu02g1834 Cmu-Chr2:32255880 3.30E-46 transposed
Cmu01g2379 Cmu-Chr1:35827536 Cmu02g1834 Cmu-Chr2:32255880 2.60E-145 wgd
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi12g46 . . . . . . . . . . Cma02g00036 Cma20g00260 . . . . . . . . . . . . Cla02g01804 Cam02g1907 Cec02g1928 Cco02g1970 Clacu02g1889 Cmu02g1834 Cre02g2152 . . . . Lsi10g01537 . Chy11g01011 . . . . . . . . . . Cmo02g00036 Cmo20g00287 . . . . Cpe16g00726 . Bhi10g00982 . . . . . . . . . . . . . . Csa06g01182 . Cme11g01575
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmu03g0783 . 1 451 Chloroplast and Mitochondria Gene Families AT2G28800 61.2 2.1e-139 492.7
Cmu08g1686 . 72 412 Chloroplast and Mitochondria Gene Families AT2G28800 57.2 1.2e-99 360.5
Cmu08g0638 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 3.7e-120 427.9
Cmu02g0278 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 1.1e-142 503.1
Cmu02g1834 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 6.7e-121 430.6
Cmu01g2379 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 3.3e-120 428.3
Cmu01g2380 . 46 309 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.8e-119 425.2
Cmu10g1951 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 78.0 6.2e-119 424.1
Cmu08g0181 . 109 312 Chloroplast and Mitochondria Gene Families AT3G27690 53.8 6.6e-52 201.4
Cmu11g1374 . 3 268 Chloroplast and Mitochondria Gene Families AT3G61470 80.9 1.3e-128 456.1
Cmu03g2095 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 1.2e-86 316.6
Cmu06g1664 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 50.8 8.4e-64 240.7
Cmu09g1969 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 5.7e-90 327.4
Cmu10g2907 . 2 267 Chloroplast and Mitochondria Gene Families AT3G08940 84.3 2.3e-126 448.7
Cmu04g0760 . 3 252 Chloroplast and Mitochondria Gene Families AT3G08940 80.1 1.5e-114 409.5
Cmu11g1896 . 60 340 Chloroplast and Mitochondria Gene Families AT1G76570 78.3 1.1e-132 469.9
Cmu03g1784 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.8 7.9e-137 483.4
Cmu02g0278 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 2.9e-144 508.1
Cmu01g2379 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 1.0e-120 429.9
Cmu01g2380 . 49 309 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 5.0e-120 427.6
Cmu02g1834 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 6.6e-120 427.2
Cmu10g1951 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 84.5 1.6e-118 422.5
Cmu08g0181 . 109 312 Chloroplast and Mitochondria Gene Families AT2G05070 54.3 4.5e-52 201.8
Cmu02g0278 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.6e-125 446.0
Cmu01g2379 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.6e-102 367.9
Cmu01g2380 . 49 281 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 1.6e-101 366.3
Cmu02g1834 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 4.8e-101 364.8
Cmu10g1951 . 27 237 Chloroplast and Mitochondria Gene Families AT2G05100 83.4 1.8e-100 362.8
Cmu08g0181 . 109 296 Chloroplast and Mitochondria Gene Families AT2G05100 53.1 1.6e-43 173.7
Cmu04g0760 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.2 2.9e-66 248.4
Cmu10g2907 . 2 164 Chloroplast and Mitochondria Gene Families AT2G40100 67.9 1.1e-60 229.9
Cmu02g1834 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.7e-136 482.3
Cmu01g2379 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 3.9e-136 481.1
Cmu01g2380 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 6.6e-136 480.3
Cmu10g1951 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 84.9 1.6e-126 449.1
Cmu02g0278 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.4e-116 414.8
Cmu03g1291 . 1 240 Chloroplast and Mitochondria Gene Families AT1G29930 56.5 9.4e-66 247.3
Cmu08g0181 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29930 50.7 7.0e-53 204.5
Cmu02g1834 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 6.6e-136 480.3
Cmu01g2379 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 1.5e-135 479.2
Cmu01g2380 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 2.5e-135 478.4
Cmu10g1951 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 84.9 2.1e-126 448.7
Cmu02g0278 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.0e-116 415.6
Cmu03g1291 . 1 240 Chloroplast and Mitochondria Gene Families AT1G29920 56.1 3.6e-65 245.4
Cmu08g0181 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 7.0e-53 204.5
Cmu02g1834 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 6.6e-136 480.3
Cmu01g2379 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 1.5e-135 479.2
Cmu01g2380 . 45 309 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 2.5e-135 478.4
Cmu10g1951 . 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 84.9 2.1e-126 448.7
Cmu02g0278 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.0e-116 415.6
Cmu03g1291 . 1 240 Chloroplast and Mitochondria Gene Families AT1G29910 56.1 3.6e-65 245.4
Cmu08g0181 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 7.0e-53 204.5
Cmu08g0181 . 47 327 Chloroplast and Mitochondria Gene Families AT4G10340 84.3 1.1e-138 489.6
Cmu01g2380 . 81 297 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 3.7e-57 218.8
Cmu01g2379 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.4e-57 218.0
Cmu10g1951 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 8.3e-57 217.6
Cmu02g1834 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.1e-56 217.2
Cmu02g0278 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 3.0e-54 209.1
Cmu02g1834 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.1e-135 479.6
Cmu01g2379 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 1.6e-134 475.7
Cmu01g2380 . 45 309 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 2.7e-134 474.9
Cmu10g1951 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.7 3.2e-127 451.4
Cmu02g0278 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 6.8e-117 417.2
Cmu03g1291 . 1 240 Chloroplast and Mitochondria Gene Families AT2G34420 56.1 3.9e-64 241.9
Cmu01g2380 . 45 309 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 7.7e-137 483.4
Cmu01g2379 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 2.9e-136 481.5
Cmu02g1834 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 1.9e-135 478.8
Cmu10g1951 . 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 85.6 4.5e-129 457.6
Cmu02g0278 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 1.9e-114 409.1
Cmu03g1291 . 1 240 Chloroplast and Mitochondria Gene Families AT2G34430 55.2 1.8e-64 243.0
Cmu10g2907 . 2 267 Chloroplast and Mitochondria Gene Families AT5G01530 87.3 1.5e-133 472.6
Cmu04g0760 . 2 252 Chloroplast and Mitochondria Gene Families AT5G01530 81.3 2.3e-118 422.2
Cmu10g1585 . 123 380 Chloroplast and Mitochondria Gene Families AT5G40810 93.4 4.6e-142 500.7
Cmu10g1585 . 76 380 Chloroplast and Mitochondria Gene Families AT3G27240 85.6 2.3e-148 521.9
Cmu02g1923 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 75.3 6.9e-143 503.8
Cmu04g0726 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 64.2 9.1e-111 397.1
Cmu02g1923 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 76.4 3.0e-143 505.0
Cmu04g0726 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.5 1.7e-117 419.5
Cmu09g0529 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 2.2e-135 478.8
Cmu01g0562 . 9 312 Chloroplast and Mitochondria Gene Families AT2G47490 63.5 6.5e-111 397.5
Cmu01g0562 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 63.7 1.0e-123 440.3
Cmu09g0529 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.6 2.5e-106 382.5
Cmu03g1152 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.4 3.7e-261 897.5
Cmu02g1717 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 70.5 1.3e-242 835.9
Cmu02g0132 . 1 542 Chloroplast and Mitochondria Gene Families AT4G21490 63.2 1.1e-207 719.9
Cmu09g0077 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.3 3.3e-62 235.0
Cmu06g0963 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 57.3 1.3e-50 196.4
Cmu06g0963 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 57.8 1.7e-50 196.1
Cmu09g0077 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 53.9 1.5e-41 166.4
Cmu09g0077 . 15 186 Chloroplast and Mitochondria Gene Families AT1G72750 68.4 4.4e-62 234.6
Cmu06g0963 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 57.1 2.4e-52 202.2
Cmu05g2367 . 663 837 Chloroplast and Mitochondria Gene Families AT1G26100 69.7 1.5e-67 253.1
Cmu11g0538 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 2.1e-90 328.9
Cmu09g1275 . 23 230 Chloroplast and Mitochondria Gene Families AT4G25570 69.5 4.7e-84 308.1
Cmu01g0651 . 2 219 Chloroplast and Mitochondria Gene Families AT1G14730 52.3 9.6e-64 240.4
Cmu01g0747 . 9 356 Chloroplast and Mitochondria Gene Families AT5G14040 82.3 2.2e-169 592.0
Cmu05g1349 . 10 357 Chloroplast and Mitochondria Gene Families AT5G14040 77.2 1.0e-158 556.6
Cmu06g1868 . 39 340 Chloroplast and Mitochondria Gene Families AT5G14040 86.4 2.0e-154 542.3
Cmu02g0335 . 11 297 Chloroplast and Mitochondria Gene Families AT5G14040 52.1 1.2e-82 303.9
Cmu01g0747 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 72.0 7.3e-146 513.8
Cmu05g1349 . 11 363 Chloroplast and Mitochondria Gene Families AT3G48850 72.0 3.6e-145 511.5
Cmu06g1868 . 10 340 Chloroplast and Mitochondria Gene Families AT3G48850 68.1 1.3e-139 493.0
Cmu02g0335 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 3.6e-84 308.9
Cmu02g0335 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 76.9 1.0e-132 469.9
Cmu05g1349 . 64 362 Chloroplast and Mitochondria Gene Families AT2G17270 52.2 5.9e-88 321.2
Cmu01g0747 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.6 4.7e-85 311.6
Cmu11g0495 . 1 299 Chloroplast and Mitochondria Gene Families AT5G15640 76.8 2.9e-130 461.8
Cmu05g0749 . 17 320 Chloroplast and Mitochondria Gene Families AT5G15640 50.7 2.1e-80 296.2
Cmu05g1857 . 12 345 Chloroplast and Mitochondria Gene Families AT5G26200 66.8 1.1e-124 443.4
Cmu09g0081 . 1 344 Chloroplast and Mitochondria Gene Families AT5G26200 57.8 1.7e-104 376.3
Cmu09g0081 . 1 348 Chloroplast and Mitochondria Gene Families AT1G72820 75.8 2.2e-147 518.8
Cmu05g1857 . 1 346 Chloroplast and Mitochondria Gene Families AT1G72820 68.8 4.9e-131 464.5
Cmu01g0231 . 82 290 Chloroplast and Mitochondria Gene Families AT5G52570 51.7 9.7e-51 197.2
Cmu05g0941 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.2 1.2e-69 260.0
Cmu01g0231 . 31 204 Chloroplast and Mitochondria Gene Families AT4G25700 62.2 1.5e-56 216.5
Cmu02g0147 . 177 355 Chloroplast and Mitochondria Gene Families AT4G03320 52.2 8.4e-57 217.6
Cmu06g1353 . 43 546 Chloroplast and Mitochondria Gene Families AT2G18710 83.9 4.5e-240 827.4
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0000158 13 5 7 13 5 6 0 6 5 5 5 5 10 6 7 9 5 6 7 6 6 18 5 5 6 7 8 8 5 2 201