Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cmu10g2554 ATGAACGATTTATTCTCCTCTCGATCCTTTTCCCGCGACACCCATGTCGTTGAAATGGGCAACGCTTCCTCTTCCCCTACTGCTGTTAATCTCGACAAGTTCTTTGAAGATGTTGAATCTGTTAAAGACGAGCTCAAGGAGCTTGAGCGACTCTACACTAACCTCCGTGACTCCCATGAACAGAGCAAGACCCTTCACAATGCTAAGGCCGTCAAGGACCTCCGATCTCGCATGGATTCTGATGTTTCTCTTGCTCTCAAGAAGGCCAAGCTCATTAAAGTCCGATTGGAGGCTCTTGATCGCTCCAATGCTGCCAACCGGAGTCTCCCTGGTTGCGGTCCCGGTTCCTCTTCTGACCGGACTCGGACTTCTGTAGTCAACGGTTTGAGGAAGAAATTGCAGGACTCTATGGAGAGTTTCAATAATCTCAGGCAACAGATCTCCTCTGAGTACCGGGAGACCGTTCAGCGAAGATATTACACGGTTACTGGGGAAAATCCGGACGAGAAGACCATTGATGTACTGATATCTACAGGTGAAAGTGAGACATTTTTGCAGAAAGCCATTCAAGAACAAGGTAGAGGCAGAATTCTAGACACCATTAGTGAGATCCAGGAGAGGCATGATGCTGTAAAAGACCTGGAAAGGAACCTCAAAGAGCTGCACCAGGTTTTCTTGGACATGGCAGTCTTGGTGCATGAGCAAGGCGAGAAACTTGACGACATCGAAAGCCAAGTGAACAGGGCTCATTCTTTTGTTCGAGGCGGCACGCAGGAGTTGACAACAGCTAGAGTATACCAGAAAAACACCCGGAAATGGACAATTATTGCCATCATCATTGTGCTGCTCATTGTCATGGTGATTGTCCTCAGCCTGCAGCCTTGGAAGAAAAACAACAGTGGACCCTAA 909 47.96 MNDLFSSRSFSRDTHVVEMGNASSSPTAVNLDKFFEDVESVKDELKELERLYTNLRDSHEQSKTLHNAKAVKDLRSRMDSDVSLALKKAKLIKVRLEALDRSNAANRSLPGCGPGSSSDRTRTSVVNGLRKKLQDSMESFNNLRQQISSEYRETVQRRYYTVTGENPDEKTIDVLISTGESETFLQKAIQEQGRGRILDTISEIQERHDAVKDLERNLKELHQVFLDMAVLVHEQGEKLDDIESQVNRAHSFVRGGTQELTTARVYQKNTRKWTIIAIIIVLLIVMVIVLSLQPWKKNNSGP 302
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
10 32279926 32281567 - CmPI595203_10g025540.1 Cmu10g2554 428084

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cmu10g2554 302 SMART SynN_4 26 152 IPR006011 GO:0016020(InterPro)
Cmu10g2554 302 Pfam Syntaxin 33 236 IPR006011 GO:0016020(InterPro)
Cmu10g2554 302 FunFam Syntaxin 132 194 293 - -
Cmu10g2554 302 CDD SNARE_syntaxin1-like 200 262 - -
Cmu10g2554 302 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 28 158 - -
Cmu10g2554 302 SMART tSNARE_6 196 263 IPR000727 -
Cmu10g2554 302 Gene3D - 197 293 - -
Cmu10g2554 302 Pfam SNARE domain 237 289 IPR000727 -
Cmu10g2554 302 ProSitePatterns Syntaxin / epimorphin family signature. 207 246 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cmu10g2554 302 SUPERFAMILY t-snare proteins 30 256 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cmu10g2554 302 CDD SynN 31 188 IPR006011 GO:0016020(InterPro)
Cmu10g2554 302 Gene3D - 29 161 - -
Cmu10g2554 302 PANTHER SYNTAXIN 33 280 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cmu10g2554 302 Coils Coil 126 150 - -
Cmu10g2554 302 Coils Coil 204 224 - -
Cmu10g2554 302 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 201 263 IPR000727 -
Cmu10g2554 302 Coils Coil 31 65 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cmu10g2554 K08486 - - csv:101208931 552.747
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cmu01g1461 Cmu-Chr1:28156998 Cmu10g2554 Cmu-Chr10:32279926 1.70E-111 dispersed
Cmu03g1156 Cmu-Chr3:5977029 Cmu10g2554 Cmu-Chr10:32279926 5.60E-91 dispersed
Cmu04g0567 Cmu-Chr4:19104732 Cmu10g2554 Cmu-Chr10:32279926 7.50E-59 dispersed
Cmu10g2115 Cmu-Chr10:27095346 Cmu10g2554 Cmu-Chr10:32279926 1.50E-65 dispersed
Cmu10g2554 Cmu-Chr10:32279926 Cmu01g1899 Cmu-Chr1:32461583 1.30E-47 dispersed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cmu08g1223 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.1e-84 309.7
Cmu04g0567 . 1 309 SNARE and Associated Proteins AT1G08560 69.6 3.6e-101 365.2
Cmu01g1899 . 431 732 SNARE and Associated Proteins AT2G18260 54.4 9.3e-86 313.9
Cmu10g2554 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.4e-115 411.8
Cmu01g1461 . 26 282 SNARE and Associated Proteins AT3G11820 72.8 8.6e-103 370.5
Cmu03g1156 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 1.1e-92 337.0
Cmu10g2115 . 95 349 SNARE and Associated Proteins AT3G11820 52.5 4.8e-69 258.5
Cmu10g2554 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 5.7e-92 334.7
Cmu01g1461 . 33 282 SNARE and Associated Proteins AT3G52400 64.8 2.3e-85 312.8
Cmu03g1156 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 3.5e-81 298.9
Cmu10g2115 . 97 349 SNARE and Associated Proteins AT3G52400 50.6 5.2e-61 231.9
Cmu03g1156 . 1 299 SNARE and Associated Proteins AT4G03330 69.2 3.0e-108 388.7
Cmu10g2554 . 1 279 SNARE and Associated Proteins AT4G03330 58.2 1.5e-83 306.6
Cmu01g1461 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 3.8e-79 292.0
Cmu10g2115 . 86 349 SNARE and Associated Proteins AT4G03330 53.8 1.1e-67 253.8
Cmu03g1156 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 9.8e-128 453.4
Cmu10g2554 . 1 279 SNARE and Associated Proteins AT1G61290 63.1 4.3e-91 331.6
Cmu01g1461 . 1 297 SNARE and Associated Proteins AT1G61290 56.6 1.6e-85 313.2
Cmu10g2115 . 101 349 SNARE and Associated Proteins AT1G61290 50.6 1.9e-62 236.5
Cmu03g1156 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 1.7e-124 442.6
Cmu10g2554 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 3.4e-93 338.6
Cmu01g1461 . 1 292 SNARE and Associated Proteins AT1G11250 57.2 1.1e-86 317.0
Cmu10g2115 . 85 349 SNARE and Associated Proteins AT1G11250 50.6 4.7e-66 248.4
Cmu10g2115 . 73 368 SNARE and Associated Proteins AT3G03800 74.0 2.9e-111 398.7
Cmu02g0866 . 41 327 SNARE and Associated Proteins AT3G03800 55.6 2.0e-80 296.2
Cmu10g2115 . 73 267 SNARE and Associated Proteins AT5G08080 79.1 1.2e-77 286.6
Cmu02g0866 . 27 227 SNARE and Associated Proteins AT5G08080 58.7 1.3e-52 203.4
Cmu10g0988 . 1 253 SNARE and Associated Proteins AT5G16830 59.5 2.0e-74 276.2
Cmu10g0988 . 1 253 SNARE and Associated Proteins AT5G46860 66.0 9.7e-79 290.4
Cmu10g0988 . 1 242 SNARE and Associated Proteins AT4G17730 63.2 4.5e-73 271.6
Cmu10g0988 . 65 253 SNARE and Associated Proteins AT1G32270 59.8 1.1e-50 197.6
Cmu07g0454 . 1 336 SNARE and Associated Proteins AT5G05760 65.9 3.2e-111 398.7
Cmu08g1223 . 8 382 SNARE and Associated Proteins AT3G24350 53.1 2.1e-84 309.7
Cmu02g1513 . 35 361 SNARE and Associated Proteins AT5G26980 76.8 4.7e-128 454.5
Cmu09g0526 . 1 318 SNARE and Associated Proteins AT5G26980 66.2 2.6e-102 369.0
Cmu09g0526 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 1.1e-105 380.2
Cmu02g1513 . 35 363 SNARE and Associated Proteins AT4G02195 64.4 3.3e-105 378.6
Cmu02g1513 . 35 362 SNARE and Associated Proteins AT3G05710 76.3 3.9e-130 461.5
Cmu09g0526 . 1 318 SNARE and Associated Proteins AT3G05710 63.7 1.0e-98 357.1
Cmu09g1057 . 91 323 SNARE and Associated Proteins AT1G16240 72.1 2.4e-89 325.5
Cmu10g1294 . 905 1137 SNARE and Associated Proteins AT1G16240 67.8 3.3e-83 305.1
Cmu09g1057 . 90 323 SNARE and Associated Proteins AT1G79590 71.4 3.9e-88 321.6
Cmu10g1294 . 900 1137 SNARE and Associated Proteins AT1G79590 67.2 1.5e-84 309.7
Cmu06g0051 . 114 304 SNARE and Associated Proteins AT1G28490 71.7 8.3e-67 250.4
Cmu10g2760 . 1 264 SNARE and Associated Proteins AT3G09740 79.7 2.7e-113 405.2
Cmu02g2099 . 1 265 SNARE and Associated Proteins AT3G09740 67.8 1.5e-95 346.3
Cmu02g2099 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 7.6e-92 334.0
Cmu10g2760 . 1 264 SNARE and Associated Proteins AT3G45280 64.4 8.7e-88 320.5
Cmu10g2760 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 7.2e-95 344.0
Cmu02g2099 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 3.0e-85 312.0
Cmu11g0646 . 65 290 SNARE and Associated Proteins AT1G51740 69.3 1.2e-78 290.0
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62