Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cone19ag0431 ATGAACGACTTATTTTCCTCCGGCTCTTTCTCTCGCGACCGGTACTCGATCGAGATGACCAACACGGAGTCGCCGACGGCCGTCAACCTCGACAAGTTCTTCGAGGACGTGGAGTCGGTCAAGGACGAGTTGAAGGAGCTGGAGCGGCTCCATCTCAGCCTCCACAACTCGCACGAGCAGAGCAAGACGCTCCACAATGCTAAGGCTGTTAAGGATCTCCGATCTCGCATGGATTCTGATGTTTCTCTTGCGTTGAAGAAGGCGAAGCTGATCAAGGTTCGATTGGAAGCTCTAGATCGCTCTAATGCTGCGAATCGAAGCTTACCTGGTTGTGGACCTGGCTCTTCGTCGGACCGGACTAGGACTTCTGTAGTCAACGGGCTGAGGAAGAAGCTCAAGGAAGCTATGGACAGCTTCAATGTTCTCCGGCAGCAGATTTCTGCTGAGTACAGAGAGACCGTTCAGCGCCGAGTTTTCACCGTCACCGGTGAAAATCCAGATGAGAAGACCGTCGATCGCATGATCTCTACAGGAGAAAGCGAGACATTCTTGCAAAAGGCGATCCAAGAACAAGGCAGAGGCAGAGTTTTGGACACCATAAATGAGATTCAAGAGAGGCATGATGCTGTCAAAGAGATGGAAAAAAACCTACAGGAGTTGCACCAAGTATTCTTGGACATGGCGGTTTTGGTGCAGGCTCAAGGCGAGCAACTAGATGACATAGAGAACCAGGTGGCGAGAGCTCATTCGTTTGTCAGAGGAGGGACTCAGCAGCTGCAGCAGGCTAAGGTACACCAGAAAAATACTCGGAAATGGACTTGTTACGCCATCATTCTACTGCTGGTCATCATCTTGATAGTGATTCTTAGTTTGAAGCCATGGAACTGGTAA 891 50.39 MNDLFSSGSFSRDRYSIEMTNTESPTAVNLDKFFEDVESVKDELKELERLHLSLHNSHEQSKTLHNAKAVKDLRSRMDSDVSLALKKAKLIKVRLEALDRSNAANRSLPGCGPGSSSDRTRTSVVNGLRKKLKEAMDSFNVLRQQISAEYRETVQRRVFTVTGENPDEKTVDRMISTGESETFLQKAIQEQGRGRVLDTINEIQERHDAVKEMEKNLQELHQVFLDMAVLVQAQGEQLDDIENQVARAHSFVRGGTQQLQQAKVHQKNTRKWTCYAIILLLVIILIVILSLKPWNW 296
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
19 3567171 3569090 + Conep19aG0044500.1 Cone19ag0431 458868

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cone19ag0431 296 MobiDBLite consensus disorder prediction 108 122 - -
Cone19ag0431 296 Coils Coil 200 223 - -
Cone19ag0431 296 ProSitePatterns Syntaxin / epimorphin family signature. 206 245 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cone19ag0431 296 Pfam Syntaxin 32 235 IPR006011 GO:0016020(InterPro)
Cone19ag0431 296 SMART tSNARE_6 195 262 IPR000727 -
Cone19ag0431 296 Coils Coil 30 57 - -
Cone19ag0431 296 CDD SynN 30 187 IPR006011 GO:0016020(InterPro)
Cone19ag0431 296 SUPERFAMILY t-snare proteins 29 255 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cone19ag0431 296 SMART SynN_4 25 151 IPR006011 GO:0016020(InterPro)
Cone19ag0431 296 Gene3D - 28 160 - -
Cone19ag0431 296 PANTHER SYNTAXIN 32 282 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cone19ag0431 296 Gene3D - 196 292 - -
Cone19ag0431 296 Coils Coil 125 145 - -
Cone19ag0431 296 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 200 262 IPR000727 -
Cone19ag0431 296 MobiDBLite consensus disorder prediction 103 122 - -
Cone19ag0431 296 CDD SNARE_syntaxin1-like 199 261 - -
Cone19ag0431 296 FunFam Syntaxin 132 193 292 - -
Cone19ag0431 296 Pfam SNARE domain 236 288 IPR000727 -
Cone19ag0431 296 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 27 157 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cone19ag0431 K08486 - - csv:101208931 476.092
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cone19ag0431 Cone-Chr19:3567171 Cone1ag0131 Cone-Chr1:738960 3.76E-109 dispersed
Cone13ag0475 Cone-Chr13:5185404 Cone19ag0431 Cone-Chr19:3567171 2.02E-190 wgd
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cone17ag1057 . 1 335 SNARE and Associated Proteins AT3G24350 61.3 2.1e-103 373.2
Cone20ag0645 . 1 323 SNARE and Associated Proteins AT3G24350 59.7 3.0e-94 342.8
Cone3ag0576 . 1 310 SNARE and Associated Proteins AT1G08560 59.8 1.1e-92 337.4
Cone10ag0552 . 1 311 SNARE and Associated Proteins AT1G08560 59.8 1.1e-92 337.4
Cone6ag1632 . 1 280 SNARE and Associated Proteins AT2G18260 54.6 3.7e-77 285.8
Cone19ag0431 . 19 278 SNARE and Associated Proteins AT3G11820 80.5 1.9e-113 406.4
Cone13ag0475 . 19 278 SNARE and Associated Proteins AT3G11820 78.5 3.8e-109 392.1
Cone1ag0131 . 31 281 SNARE and Associated Proteins AT3G11820 64.5 3.3e-89 325.9
Cone5ag1736 . 31 281 SNARE and Associated Proteins AT3G11820 62.9 4.8e-88 322.0
Cone13ag0457 . 32 286 SNARE and Associated Proteins AT3G11820 51.4 1.4e-66 250.8
Cone19ag0431 . 29 278 SNARE and Associated Proteins AT3G52400 69.2 2.9e-91 332.8
Cone13ag0475 . 29 278 SNARE and Associated Proteins AT3G52400 68.0 3.6e-89 325.9
Cone1ag0131 . 1 281 SNARE and Associated Proteins AT3G52400 54.0 6.4e-78 288.5
Cone5ag1736 . 1 281 SNARE and Associated Proteins AT3G52400 53.3 7.0e-77 285.0
Cone1ag0131 . 1 294 SNARE and Associated Proteins AT4G03330 69.0 8.4e-106 380.9
Cone5ag1736 . 1 294 SNARE and Associated Proteins AT4G03330 67.7 3.5e-104 375.6
Cone19ag0431 . 1 279 SNARE and Associated Proteins AT4G03330 58.7 1.2e-83 307.4
Cone13ag0475 . 1 279 SNARE and Associated Proteins AT4G03330 56.5 6.5e-82 301.6
Cone3ag1346 . 37 263 SNARE and Associated Proteins AT4G03330 50.2 6.1e-56 215.3
Cone1ag0131 . 1 293 SNARE and Associated Proteins AT1G61290 72.7 8.3e-114 407.5
Cone5ag1736 . 1 293 SNARE and Associated Proteins AT1G61290 72.7 3.2e-113 405.6
Cone19ag0431 . 1 279 SNARE and Associated Proteins AT1G61290 63.1 5.3e-92 335.1
Cone13ag0475 . 1 279 SNARE and Associated Proteins AT1G61290 63.5 1.2e-91 334.0
Cone1ag0131 . 1 293 SNARE and Associated Proteins AT1G11250 73.0 9.1e-113 404.1
Cone5ag1736 . 1 293 SNARE and Associated Proteins AT1G11250 71.3 1.9e-110 396.4
Cone19ag0431 . 1 279 SNARE and Associated Proteins AT1G11250 63.4 3.2e-94 342.4
Cone13ag0475 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 4.7e-93 338.6
Cone13ag0457 . 1 303 SNARE and Associated Proteins AT3G03800 73.6 1.5e-115 413.3
Cone3ag0557 . 1 305 SNARE and Associated Proteins AT3G03800 69.2 2.8e-109 392.5
Cone10ag0529 . 1 305 SNARE and Associated Proteins AT3G03800 66.2 3.2e-105 379.0
Cone3ag1346 . 6 281 SNARE and Associated Proteins AT3G03800 62.3 4.4e-86 315.5
Cone13ag0457 . 1 204 SNARE and Associated Proteins AT5G08080 76.0 2.1e-77 286.2
Cone3ag0557 . 1 203 SNARE and Associated Proteins AT5G08080 71.9 2.8e-74 275.8
Cone10ag0529 . 1 203 SNARE and Associated Proteins AT5G08080 67.0 7.4e-67 251.1
Cone3ag1346 . 13 180 SNARE and Associated Proteins AT5G08080 67.9 1.2e-53 207.2
Cone15ag0918 . 1 256 SNARE and Associated Proteins AT5G16830 58.6 2.3e-73 273.1
Cone12ag0481 . 1 263 SNARE and Associated Proteins AT5G16830 58.0 5.0e-73 271.9
Cone14ag0930 . 1 252 SNARE and Associated Proteins AT5G16830 57.1 4.3e-72 268.9
Cone8ag0484 . 1 262 SNARE and Associated Proteins AT5G16830 56.1 8.0e-71 264.6
Cone14ag0931 . 1 137 SNARE and Associated Proteins AT5G16830 59.7 5.3e-38 155.6
Cone8ag0484 . 1 273 SNARE and Associated Proteins AT5G46860 62.6 2.7e-76 282.7
Cone12ag0481 . 1 274 SNARE and Associated Proteins AT5G46860 62.0 4.4e-74 275.4
Cone14ag0930 . 1 252 SNARE and Associated Proteins AT5G46860 53.2 7.2e-61 231.5
Cone15ag0918 . 1 256 SNARE and Associated Proteins AT5G46860 52.7 7.2e-61 231.5
Cone14ag0931 . 1 140 SNARE and Associated Proteins AT5G46860 66.4 6.2e-44 175.3
Cone8ag0484 . 1 256 SNARE and Associated Proteins AT4G17730 58.5 3.2e-69 259.2
Cone12ag0481 . 1 257 SNARE and Associated Proteins AT4G17730 58.0 3.5e-68 255.8
Cone14ag0930 . 1 244 SNARE and Associated Proteins AT4G17730 53.0 1.4e-61 233.8
Cone15ag0918 . 1 256 SNARE and Associated Proteins AT4G17730 51.9 2.4e-61 233.0
Cone14ag0931 . 1 140 SNARE and Associated Proteins AT4G17730 66.7 5.6e-42 168.7
Cone8ag0484 . 64 255 SNARE and Associated Proteins AT1G32270 60.4 6.0e-52 202.2
Cone12ag0481 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.0e-51 201.4
Cone14ag0930 . 64 252 SNARE and Associated Proteins AT1G32270 57.7 1.1e-48 191.4
Cone15ag0918 . 64 255 SNARE and Associated Proteins AT1G32270 55.7 1.2e-47 188.0
Cone5ag0210 . 1 338 SNARE and Associated Proteins AT5G05760 68.8 1.2e-118 423.7
Cone17ag1057 . 1 335 SNARE and Associated Proteins AT3G24350 61.3 2.1e-103 373.2
Cone20ag0645 . 1 323 SNARE and Associated Proteins AT3G24350 59.7 3.0e-94 342.8
Cone3ag0826 . 1 328 SNARE and Associated Proteins AT5G26980 75.9 1.0e-125 447.2
Cone10ag0804 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 8.5e-125 444.1
Cone17ag0442 . 1 321 SNARE and Associated Proteins AT5G26980 70.9 4.1e-111 398.7
Cone20ag0971 . 1 223 SNARE and Associated Proteins AT5G26980 53.1 3.1e-50 196.4
Cone17ag0442 . 1 319 SNARE and Associated Proteins AT4G02195 68.2 1.6e-110 396.7
Cone3ag0826 . 1 329 SNARE and Associated Proteins AT4G02195 66.5 5.2e-106 381.7
Cone10ag0804 . 1 328 SNARE and Associated Proteins AT4G02195 64.8 1.7e-104 376.7
Cone20ag0971 . 1 223 SNARE and Associated Proteins AT4G02195 50.4 1.3e-48 191.0
Cone3ag0826 . 1 327 SNARE and Associated Proteins AT3G05710 75.5 4.2e-127 451.8
Cone10ag0804 . 1 326 SNARE and Associated Proteins AT3G05710 75.5 4.7e-126 448.4
Cone17ag0442 . 1 319 SNARE and Associated Proteins AT3G05710 68.4 4.0e-109 392.1
Cone9ag0047 . 1 233 SNARE and Associated Proteins AT1G16240 74.2 4.9e-90 328.2
Cone6ag0041 . 1 232 SNARE and Associated Proteins AT1G16240 74.2 1.2e-88 323.6
Cone15ag1202 . 1 234 SNARE and Associated Proteins AT1G16240 63.2 2.0e-75 279.6
Cone14ag1185 . 1 189 SNARE and Associated Proteins AT1G16240 63.5 2.3e-63 239.6
Cone6ag0041 . 1 232 SNARE and Associated Proteins AT1G79590 75.1 1.3e-91 333.6
Cone9ag0047 . 1 233 SNARE and Associated Proteins AT1G79590 73.0 3.6e-89 325.5
Cone15ag1202 . 1 234 SNARE and Associated Proteins AT1G79590 63.7 2.7e-76 282.7
Cone14ag1185 . 1 189 SNARE and Associated Proteins AT1G79590 64.0 8.2e-65 244.6
Cone14ag1146 . 56 247 SNARE and Associated Proteins AT1G28490 71.4 2.5e-66 249.2
Cone15ag1164 . 13 213 SNARE and Associated Proteins AT1G28490 67.8 9.5e-66 247.3
Cone19ag1262 . 1 265 SNARE and Associated Proteins AT3G09740 81.2 1.7e-115 412.9
Cone13ag1275 . 1 265 SNARE and Associated Proteins AT3G09740 80.8 1.1e-114 410.2
Cone5ag1222 . 1 233 SNARE and Associated Proteins AT3G09740 53.1 3.3e-58 222.6
Cone13ag1275 . 1 265 SNARE and Associated Proteins AT3G45280 64.0 1.0e-86 317.4
Cone19ag1262 . 1 265 SNARE and Associated Proteins AT3G45280 63.3 1.7e-86 316.6
Cone5ag1222 . 1 230 SNARE and Associated Proteins AT3G45280 53.8 2.5e-61 233.0
Cone13ag1275 . 1 262 SNARE and Associated Proteins AT3G61450 66.8 2.9e-91 332.4
Cone19ag1262 . 1 262 SNARE and Associated Proteins AT3G61450 66.0 1.5e-90 330.1
Cone11ag1168 . 65 309 SNARE and Associated Proteins AT1G51740 76.4 1.7e-96 349.7
Cone18ag0421 . 65 309 SNARE and Associated Proteins AT1G51740 76.8 6.4e-96 347.8
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002313 5 3 2 3 3 1 2 1 1 2 1 2 2 2 2 2 2 2 3 1 3 2 2 2 3 1 2 3 2 0 62