Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cone20ag1320 ATGGAGCACCAGACCTCGAATCACGATCAAGAACGAGGCGTGGATTTCGAAGGATCAAAGCCACGCCTTTACAATCCCTACAAGGACCTTCAAGTTCCGACTTATCGAAACTTCCAGCTCCCTACCTCACCTGAGTTCCTCTTCGACGAAGAGGCTCGCCACCAGCGCCGATCTTGGGGCGAGAACCTCACTTTCTACACCGGATGTGGTTACCTTGCAGGTTCAGTAGCCGGAGCCGCCAACGGCTTCGTCAGCGGCGTCAAATCATTCGAATCCGGAGATACGATGAAGCTCAGGATCAATCGCGTTCTGAACTCTTCAGGTCATTCGGGTCGTGTTTGGGGTAACCGTCTCGGCGTGATCGGGCTGATATATGCAGGTATAGAGAGCGGGATTGTAGAGCTGAGAGATACCGACGATTCATGGAATAGCGTTGCGGCGGGGCTTGGTACTGGAGCTCTTTACCGAGCGGCGAGAGGCGTGAGATCTGCGGCGGTGGCAGGGGCTATAGGAGGCGTGTTGGTGGGTGTGGCGGTGACAGCTAGGCAGGCGTTGAAGCGCTACGTGCCGATATGA 576 55.73 MEHQTSNHDQERGVDFEGSKPRLYNPYKDLQVPTYRNFQLPTSPEFLFDEEARHQRRSWGENLTFYTGCGYLAGSVAGAANGFVSGVKSFESGDTMKLRINRVLNSSGHSGRVWGNRLGVIGLIYAGIESGIVELRDTDDSWNSVAAGLGTGALYRAARGVRSAAVAGAIGGVLVGVAVTARQALKRYVPI 191
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
20 8554650 8555588 - Conep20aG0136600.1 Cone20ag1320 461224

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cone20ag1320 191 Pfam Tim17/Tim22/Tim23/Pmp24 family 64 174 - -
Cone20ag1320 191 MobiDBLite consensus disorder prediction 1 18 - -
Cone20ag1320 191 MobiDBLite consensus disorder prediction 1 20 - -
Cone20ag1320 191 PANTHER TIM23 38 179 IPR045238 GO:0005744(PANTHER)|GO:0008320(PANTHER)|GO:0022857(InterPro)|GO:0030150(PANTHER)|GO:0031305(PANTHER)
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cone20ag1320 K17794 - - csv:101221925 289.656
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cone17ag0084 Cone-Chr17:467789 Cone20ag1320 Cone-Chr20:8554650 3.24E-128 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cone11ag1248 . 1 455 Chloroplast and Mitochondria Gene Families AT2G28800 62.6 3.8e-144 508.8
Cone18ag0342 . 1 457 Chloroplast and Mitochondria Gene Families AT2G28800 62.2 8.4e-144 507.7
Cone13ag1100 . 78 412 Chloroplast and Mitochondria Gene Families AT2G28800 58.2 2.4e-98 356.7
Cone19ag1088 . 77 413 Chloroplast and Mitochondria Gene Families AT2G28800 57.8 2.7e-97 353.2
Cone10ag0924 . 3 257 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 1.2e-121 433.3
Cone3ag0950 . 3 257 Chloroplast and Mitochondria Gene Families AT1G15820 82.0 9.6e-119 423.7
Cone8ag1383 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.8 5.8e-144 507.7
Cone6ag0906 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.9 3.1e-121 432.2
Cone9ag0912 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.6 4.1e-121 431.8
Cone9ag0914 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.6 4.1e-121 431.8
Cone3ag1486 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 76.8 2.0e-120 429.5
Cone1ag0250 . 1 267 Chloroplast and Mitochondria Gene Families AT3G27690 74.1 9.4e-118 420.6
Cone9ag0132 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 68.1 6.3e-98 354.8
Cone6ag0112 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 66.3 7.7e-96 347.8
Cone11ag1332 . 115 341 Chloroplast and Mitochondria Gene Families AT3G27690 51.5 4.3e-54 209.1
Cone4ag0090 . 62 274 Chloroplast and Mitochondria Gene Families AT3G27690 52.8 2.1e-53 206.8
Cone7ag0081 . 111 323 Chloroplast and Mitochondria Gene Families AT3G27690 52.3 8.1e-53 204.9
Cone3ag1170 . 2 160 Chloroplast and Mitochondria Gene Families AT3G27690 61.4 5.2e-52 202.2
Cone13ag0367 . 6 265 Chloroplast and Mitochondria Gene Families AT3G61470 82.4 8.6e-128 453.8
Cone12ag0808 . 1 268 Chloroplast and Mitochondria Gene Families AT3G61470 78.4 3.4e-124 441.8
Cone8ag0754 . 1 268 Chloroplast and Mitochondria Gene Families AT3G61470 78.0 9.9e-124 440.3
Cone4ag0830 . 66 271 Chloroplast and Mitochondria Gene Families AT3G61470 68.9 2.1e-86 316.2
Cone2ag0840 . 22 247 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 1.8e-64 243.4
Cone16ag0175 . 22 246 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 3.9e-64 242.3
Cone5ag0333 . 1 197 Chloroplast and Mitochondria Gene Families AT3G54890 83.8 7.5e-93 337.4
Cone1ag1346 . 1 199 Chloroplast and Mitochondria Gene Families AT3G54890 83.0 2.4e-91 332.4
Cone3ag0419 . 3 288 Chloroplast and Mitochondria Gene Families AT3G08940 83.6 3.0e-137 485.3
Cone10ag0383 . 3 288 Chloroplast and Mitochondria Gene Families AT3G08940 83.3 6.6e-137 484.2
Cone1ag1220 . 61 334 Chloroplast and Mitochondria Gene Families AT3G08940 71.3 1.0e-105 380.6
Cone11ag1332 . 27 345 Chloroplast and Mitochondria Gene Families AT1G76570 77.1 8.9e-146 513.8
Cone18ag0141 . 1 271 Chloroplast and Mitochondria Gene Families AT1G61520 84.1 2.0e-130 462.6
Cone11ag1448 . 1 271 Chloroplast and Mitochondria Gene Families AT1G61520 83.7 9.8e-130 460.3
Cone8ag1383 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 5.2e-144 507.7
Cone9ag0912 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.6e-121 433.0
Cone9ag0914 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.6e-121 433.0
Cone6ag0906 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.4 2.8e-121 432.2
Cone3ag1486 . 5 267 Chloroplast and Mitochondria Gene Families AT2G05070 79.5 8.1e-121 430.6
Cone1ag0250 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 75.7 1.1e-117 420.2
Cone9ag0132 . 11 264 Chloroplast and Mitochondria Gene Families AT2G05070 69.6 2.5e-98 355.9
Cone6ag0112 . 11 264 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 9.0e-96 347.4
Cone4ag0090 . 62 274 Chloroplast and Mitochondria Gene Families AT2G05070 53.2 1.4e-53 207.2
Cone7ag0081 . 111 323 Chloroplast and Mitochondria Gene Families AT2G05070 52.8 5.5e-53 205.3
Cone11ag1332 . 115 338 Chloroplast and Mitochondria Gene Families AT2G05070 50.9 1.6e-52 203.8
Cone3ag1170 . 5 160 Chloroplast and Mitochondria Gene Families AT2G05070 61.4 2.1e-52 203.4
Cone8ag1383 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.0 2.2e-125 446.0
Cone9ag0912 . 5 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.6 2.0e-102 369.8
Cone9ag0914 . 5 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.6 2.0e-102 369.8
Cone6ag0906 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 4.5e-102 368.6
Cone3ag1486 . 5 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.3 2.9e-101 365.9
Cone1ag0250 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 73.1 2.1e-99 359.8
Cone9ag0132 . 11 236 Chloroplast and Mitochondria Gene Families AT2G05100 68.9 2.3e-82 303.1
Cone6ag0112 . 11 236 Chloroplast and Mitochondria Gene Families AT2G05100 66.8 6.3e-80 295.0
Cone3ag1170 . 5 160 Chloroplast and Mitochondria Gene Families AT2G05100 62.0 2.5e-52 203.4
Cone4ag0090 . 62 258 Chloroplast and Mitochondria Gene Families AT2G05100 52.0 5.0e-45 179.1
Cone7ag0081 . 111 307 Chloroplast and Mitochondria Gene Families AT2G05100 51.5 1.9e-44 177.2
Cone1ag1220 . 63 233 Chloroplast and Mitochondria Gene Families AT2G40100 68.2 1.5e-65 246.5
Cone3ag0419 . 4 170 Chloroplast and Mitochondria Gene Families AT2G40100 68.6 9.8e-65 243.8
Cone10ag0383 . 4 170 Chloroplast and Mitochondria Gene Families AT2G40100 67.4 3.5e-62 235.3
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 1.2e-137 486.5
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 1.2e-137 486.5
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 2.3e-136 482.3
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 3.1e-136 481.9
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT1G29930 86.1 1.3e-131 466.5
Cone8ag1383 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 77.5 1.8e-115 412.9
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29930 71.1 4.5e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29930 70.2 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT1G29930 72.9 2.9e-62 236.1
Cone4ag0090 . 71 274 Chloroplast and Mitochondria Gene Families AT1G29930 54.2 5.9e-55 211.8
Cone7ag0081 . 110 323 Chloroplast and Mitochondria Gene Families AT1G29930 52.7 7.7e-55 211.5
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 4.7e-137 484.6
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 4.7e-137 484.6
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 8.9e-136 480.3
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 1.2e-135 479.9
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT1G29920 85.7 5.1e-131 464.5
Cone8ag1383 . 33 265 Chloroplast and Mitochondria Gene Families AT1G29920 83.5 3.0e-115 412.1
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29920 71.1 4.5e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29920 70.2 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT1G29920 72.3 1.1e-61 234.2
Cone4ag0090 . 71 274 Chloroplast and Mitochondria Gene Families AT1G29920 54.2 5.9e-55 211.8
Cone7ag0081 . 110 323 Chloroplast and Mitochondria Gene Families AT1G29920 52.7 7.7e-55 211.5
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 4.7e-137 484.6
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 4.7e-137 484.6
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 8.9e-136 480.3
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 1.2e-135 479.9
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT1G29910 85.7 5.1e-131 464.5
Cone8ag1383 . 33 265 Chloroplast and Mitochondria Gene Families AT1G29910 83.5 3.0e-115 412.1
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29910 71.1 4.5e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29910 70.2 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT1G29910 72.3 1.1e-61 234.2
Cone4ag0090 . 71 274 Chloroplast and Mitochondria Gene Families AT1G29910 54.2 5.9e-55 211.8
Cone7ag0081 . 110 323 Chloroplast and Mitochondria Gene Families AT1G29910 52.7 7.7e-55 211.5
Cone4ag0090 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 87.5 3.3e-141 498.4
Cone7ag0081 . 58 338 Chloroplast and Mitochondria Gene Families AT4G10340 85.1 1.8e-139 492.7
Cone6ag0906 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 5.1e-57 218.8
Cone9ag0912 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 5.1e-57 218.8
Cone9ag0914 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 5.1e-57 218.8
Cone3ag1486 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.5e-56 217.2
Cone1ag0250 . 39 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 7.3e-56 214.9
Cone8ag1383 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 2.8e-55 213.0
Cone9ag0132 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 51.9 2.4e-51 199.9
Cone6ag0112 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 51.9 4.2e-51 199.1
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 89.1 5.2e-136 481.1
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 89.1 5.2e-136 481.1
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 89.1 4.4e-135 478.0
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.1 1.3e-134 476.5
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT2G34420 86.5 2.5e-130 462.2
Cone8ag1383 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 76.0 1.3e-115 413.3
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34420 71.5 4.4e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34420 70.7 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT2G34420 72.3 2.7e-60 229.6
Cone7ag0081 . 110 323 Chloroplast and Mitochondria Gene Families AT2G34420 51.8 3.8e-54 209.1
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 5.8e-135 477.6
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 5.8e-135 477.6
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 1.3e-134 476.5
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 87.3 1.1e-133 473.4
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT2G34430 86.0 3.9e-131 464.9
Cone8ag1383 . 30 265 Chloroplast and Mitochondria Gene Families AT2G34430 82.8 2.5e-114 409.1
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 72.2 4.5e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 71.4 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT2G34430 72.7 6.5e-62 235.0
Cone4ag0090 . 71 274 Chloroplast and Mitochondria Gene Families AT2G34430 53.3 3.8e-54 209.1
Cone7ag0081 . 120 323 Chloroplast and Mitochondria Gene Families AT2G34430 53.3 8.5e-54 208.0
Cone3ag0419 . 1 288 Chloroplast and Mitochondria Gene Families AT5G01530 83.8 4.2e-139 491.5
Cone10ag0383 . 1 288 Chloroplast and Mitochondria Gene Families AT5G01530 83.2 1.0e-137 486.9
Cone1ag1220 . 61 334 Chloroplast and Mitochondria Gene Families AT5G01530 72.7 8.6e-108 387.5
Cone18ag1406 . 42 301 Chloroplast and Mitochondria Gene Families AT5G40810 91.5 2.4e-141 498.8
Cone11ag0071 . 350 609 Chloroplast and Mitochondria Gene Families AT5G40810 91.2 5.8e-140 494.2
Cone11ag0071 . 301 609 Chloroplast and Mitochondria Gene Families AT3G27240 84.5 7.3e-150 527.3
Cone18ag1406 . 30 301 Chloroplast and Mitochondria Gene Families AT3G27240 90.1 3.0e-143 505.4
Cone5ag1055 . 1 324 Chloroplast and Mitochondria Gene Families AT2G30160 73.3 1.0e-141 500.4
Cone1ag0764 . 5 185 Chloroplast and Mitochondria Gene Families AT2G30160 69.4 3.6e-70 262.7
Cone5ag1055 . 1 324 Chloroplast and Mitochondria Gene Families AT1G07030 73.1 3.3e-140 495.4
Cone1ag0764 . 1 185 Chloroplast and Mitochondria Gene Families AT1G07030 65.1 4.1e-66 249.2
Cone20ag0967 . 7 316 Chloroplast and Mitochondria Gene Families AT2G47490 77.1 1.5e-137 486.5
Cone17ag0445 . 1 315 Chloroplast and Mitochondria Gene Families AT2G47490 73.3 2.0e-134 476.1
Cone9ag0448 . 24 324 Chloroplast and Mitochondria Gene Families AT2G47490 62.0 1.4e-108 390.2
Cone6ag0430 . 24 326 Chloroplast and Mitochondria Gene Families AT2G47490 61.2 7.0e-108 387.9
Cone9ag0448 . 25 373 Chloroplast and Mitochondria Gene Families AT1G25380 63.1 7.6e-122 434.5
Cone6ag0430 . 32 375 Chloroplast and Mitochondria Gene Families AT1G25380 64.0 4.2e-120 428.7
Cone20ag0967 . 10 302 Chloroplast and Mitochondria Gene Families AT1G25380 66.1 8.8e-110 394.4
Cone17ag0445 . 9 301 Chloroplast and Mitochondria Gene Families AT1G25380 64.7 1.3e-108 390.6
Cone6ag1051 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 73.2 3.2e-255 878.2
Cone9ag1046 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 72.9 1.9e-252 869.0
Cone12ag1430 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 68.5 3.8e-240 828.2
Cone8ag1493 . 5 576 Chloroplast and Mitochondria Gene Families AT4G21490 65.7 1.7e-224 776.2
Cone12ag1429 . 7 573 Chloroplast and Mitochondria Gene Families AT4G21490 66.1 8.5e-224 773.9
Cone20ag1320 . 22 187 Chloroplast and Mitochondria Gene Families AT1G17530 68.5 1.6e-59 226.5
Cone17ag0084 . 22 187 Chloroplast and Mitochondria Gene Families AT1G17530 66.1 3.3e-57 218.8
Cone20ag1320 . 1 191 Chloroplast and Mitochondria Gene Families AT3G04800 51.0 1.3e-43 173.7
Cone17ag0084 . 22 191 Chloroplast and Mitochondria Gene Families AT3G04800 52.6 1.5e-41 166.8
Cone20ag1320 . 22 191 Chloroplast and Mitochondria Gene Families AT1G72750 69.4 4.6e-62 235.0
Cone17ag0084 . 22 191 Chloroplast and Mitochondria Gene Families AT1G72750 68.2 1.1e-60 230.3
Cone6ag0477 . 1 168 Chloroplast and Mitochondria Gene Families AT1G26100 66.1 1.2e-56 217.2
Cone11ag0327 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 72.7 7.3e-94 340.9
Cone14ag0090 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 73.5 9.2e-83 304.3
Cone15ag0096 . 23 206 Chloroplast and Mitochondria Gene Families AT4G25570 66.3 1.5e-72 270.4
Cone9ag0373 . 1 224 Chloroplast and Mitochondria Gene Families AT1G14730 58.5 1.2e-69 260.4
Cone6ag0339 . 4 225 Chloroplast and Mitochondria Gene Families AT1G14730 58.1 1.0e-68 257.3
Cone11ag0021 . 9 367 Chloroplast and Mitochondria Gene Families AT5G14040 80.9 3.3e-168 588.6
Cone18ag1459 . 8 361 Chloroplast and Mitochondria Gene Families AT5G14040 79.2 4.4e-165 578.2
Cone19ag0236 . 54 362 Chloroplast and Mitochondria Gene Families AT5G14040 78.2 4.3e-144 508.4
Cone10ag1210 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.7 2.0e-88 323.6
Cone18ag1459 . 10 361 Chloroplast and Mitochondria Gene Families AT3G48850 71.7 1.6e-143 506.5
Cone11ag0021 . 11 365 Chloroplast and Mitochondria Gene Families AT3G48850 70.6 1.5e-141 500.0
Cone19ag0236 . 55 362 Chloroplast and Mitochondria Gene Families AT3G48850 76.6 5.3e-139 491.5
Cone10ag1210 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 52.6 4.7e-87 318.9
Cone10ag1210 . 8 308 Chloroplast and Mitochondria Gene Families AT2G17270 74.2 1.4e-132 469.9
Cone11ag0021 . 63 363 Chloroplast and Mitochondria Gene Families AT2G17270 53.2 1.4e-87 320.5
Cone18ag1459 . 63 364 Chloroplast and Mitochondria Gene Families AT2G17270 51.7 1.2e-86 317.4
Cone18ag1144 . 16 317 Chloroplast and Mitochondria Gene Families AT5G15640 79.6 4.0e-135 478.4
Cone11ag0356 . 16 317 Chloroplast and Mitochondria Gene Families AT5G15640 78.3 2.9e-133 472.2
Cone15ag0699 . 12 318 Chloroplast and Mitochondria Gene Families AT5G15640 52.8 1.8e-82 303.5
Cone7ag1604 . 13 348 Chloroplast and Mitochondria Gene Families AT5G26200 65.5 4.4e-119 425.2
Cone4ag1686 . 13 348 Chloroplast and Mitochondria Gene Families AT5G26200 64.0 3.5e-116 415.6
Cone7ag1234 . 14 343 Chloroplast and Mitochondria Gene Families AT5G26200 61.7 9.7e-111 397.5
Cone7ag1234 . 7 345 Chloroplast and Mitochondria Gene Families AT1G72820 69.9 1.2e-132 470.3
Cone7ag1604 . 1 349 Chloroplast and Mitochondria Gene Families AT1G72820 64.3 7.8e-124 441.0
Cone4ag1686 . 1 349 Chloroplast and Mitochondria Gene Families AT1G72820 63.3 1.1e-120 430.6
Cone14ag0059 . 116 324 Chloroplast and Mitochondria Gene Families AT5G52570 56.9 2.3e-55 213.0
Cone15ag0063 . 121 327 Chloroplast and Mitochondria Gene Families AT5G52570 56.5 4.4e-54 208.8
Cone14ag0059 . 1 239 Chloroplast and Mitochondria Gene Families AT4G25700 57.3 6.9e-65 244.6
Cone15ag0063 . 1 244 Chloroplast and Mitochondria Gene Families AT4G25700 55.7 1.9e-62 236.5
Cone3ag1384 . 127 304 Chloroplast and Mitochondria Gene Families AT4G03320 53.6 7.9e-58 221.5
Cone14ag1086 . 22 368 Chloroplast and Mitochondria Gene Families AT5G54290 74.0 9.7e-130 460.7
Cone16ag0356 . 34 544 Chloroplast and Mitochondria Gene Families AT2G18710 82.3 3.7e-237 818.1
Cone2ag0611 . 39 384 Chloroplast and Mitochondria Gene Families AT2G18710 53.3 1.6e-118 424.1