Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cone6ag1632 ATGAATGATCTGATGACAAAATCGTTTTTAAGTTATGTGGAGTTAAAGAAACAAGCCCGGAAGGACGAACAAGATGGCAATGATTTCGACTTAGAAACAGTGTCCACCAACAAAGAAGAAGAACAAGAAGACCCCAAACTCTCCCAATTCTTCCAAGATGTTTCTTCACTCAAATCTGAAATGGAAGAGATTTCCAATCTCTTGATCGATCTTCAGGCTCTAAACTTAGAATCCAAATCAACCCACAGCGCTAAACTCCTACGCGGAATCCGAGACCGAATGGAATCCAACATGGCCTCAATCCTCCGGAAGGCCAAGACTGTCCGTTCAACCCTGGAATCGCTCGATCGAACGGCCCACAAAACCCGAAAAACCCACGTGGATAGAACAAAGATATCTGTTACTAATGGGCTTAGAGTCAAACTAAGGGAAATGATGAATGATTTTCAGGCCTTAAGGGACAAAATAGTATCAGACCACAAGGAGGATTTGAAAAGGAGATATTTTGTCAAAACAGGAGAGCAAGCAAGCGAGGAAGTGATAGAAAAGATGATGTTAGGAGGAGGGGGAGATAAAGTGGCAGTGTTTATTGAAGAAGAAGGGAAAACAGAAGATGTGGAAATGGGGAACAGAGTAAGGCATGAGGCAGTGATTGATATACAGAGGAGTTTGAACAAGCTTCATCAAGTGTTTATAGACATGGCGGTCTTGGTCGAGACTCAAGGAGAGAAGATGGACGATATAGAAGAGAATGTGGTGAATGCTGCTAGTTATGTGAGTGGTGGGACTACTAGTCTTTTTTATGCTAATCAGATGAAGAAGAAGAGTAGGAAGTGGGTTTGTTGGGTGTTGGGTGTGCTTTTCATTATATTTGTCGTTTGCCTCATTGCTATGTTGTCTTCTTGA 906 42.16 MNDLMTKSFLSYVELKKQARKDEQDGNDFDLETVSTNKEEEQEDPKLSQFFQDVSSLKSEMEEISNLLIDLQALNLESKSTHSAKLLRGIRDRMESNMASILRKAKTVRSTLESLDRTAHKTRKTHVDRTKISVTNGLRVKLREMMNDFQALRDKIVSDHKEDLKRRYFVKTGEQASEEVIEKMMLGGGGDKVAVFIEEEGKTEDVEMGNRVRHEAVIDIQRSLNKLHQVFIDMAVLVETQGEKMDDIEENVVNAASYVSGGTTSLFYANQMKKKSRKWVCWVLGVLFIIFVVCLIAMLSS 301
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
6 12550084 12550989 - Conep06aG0169600.1 Cone6ag1632 440516

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cone6ag1632 301 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 213 269 IPR000727 -
Cone6ag1632 301 FunFam Syntaxin 132 200 300 - -
Cone6ag1632 301 SUPERFAMILY t-snare proteins 45 262 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cone6ag1632 301 Pfam Syntaxin 49 242 IPR006011 GO:0016020(InterPro)
Cone6ag1632 301 CDD SynN 47 184 IPR006011 GO:0016020(InterPro)
Cone6ag1632 301 CDD SNARE_syntaxin1-like 213 266 - -
Cone6ag1632 301 SMART tSNARE_6 200 269 IPR000727 -
Cone6ag1632 301 SMART SynN_4 42 161 IPR006011 GO:0016020(InterPro)
Cone6ag1632 301 Gene3D - 42 165 - -
Cone6ag1632 301 MobiDBLite consensus disorder prediction 18 45 - -
Cone6ag1632 301 Gene3D - 198 300 - -
Cone6ag1632 301 Coils Coil 54 77 - -
Cone6ag1632 301 Pfam SNARE domain 244 293 IPR000727 -
Cone6ag1632 301 PANTHER SYNTAXIN 49 289 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cone6ag1632 K08486 - - gmx:112997615 369.007
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cone3ag1346 Cone-Chr3:32432230 Cone6ag1632 Cone-Chr6:12550084 1.08E-32 dispersed
Cone6ag1632 Cone-Chr6:12550084 Cone9ag1556 Cone-Chr9:11278763 1.94E-71 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cone17ag1057 . 1 335 SNARE and Associated Proteins AT3G24350 61.3 2.1e-103 373.2
Cone20ag0645 . 1 323 SNARE and Associated Proteins AT3G24350 59.7 3.0e-94 342.8
Cone3ag0576 . 1 310 SNARE and Associated Proteins AT1G08560 59.8 1.1e-92 337.4
Cone10ag0552 . 1 311 SNARE and Associated Proteins AT1G08560 59.8 1.1e-92 337.4
Cone6ag1632 . 1 280 SNARE and Associated Proteins AT2G18260 54.6 3.7e-77 285.8
Cone19ag0431 . 19 278 SNARE and Associated Proteins AT3G11820 80.5 1.9e-113 406.4
Cone13ag0475 . 19 278 SNARE and Associated Proteins AT3G11820 78.5 3.8e-109 392.1
Cone1ag0131 . 31 281 SNARE and Associated Proteins AT3G11820 64.5 3.3e-89 325.9
Cone5ag1736 . 31 281 SNARE and Associated Proteins AT3G11820 62.9 4.8e-88 322.0
Cone13ag0457 . 32 286 SNARE and Associated Proteins AT3G11820 51.4 1.4e-66 250.8
Cone19ag0431 . 29 278 SNARE and Associated Proteins AT3G52400 69.2 2.9e-91 332.8
Cone13ag0475 . 29 278 SNARE and Associated Proteins AT3G52400 68.0 3.6e-89 325.9
Cone1ag0131 . 1 281 SNARE and Associated Proteins AT3G52400 54.0 6.4e-78 288.5
Cone5ag1736 . 1 281 SNARE and Associated Proteins AT3G52400 53.3 7.0e-77 285.0
Cone1ag0131 . 1 294 SNARE and Associated Proteins AT4G03330 69.0 8.4e-106 380.9
Cone5ag1736 . 1 294 SNARE and Associated Proteins AT4G03330 67.7 3.5e-104 375.6
Cone19ag0431 . 1 279 SNARE and Associated Proteins AT4G03330 58.7 1.2e-83 307.4
Cone13ag0475 . 1 279 SNARE and Associated Proteins AT4G03330 56.5 6.5e-82 301.6
Cone3ag1346 . 37 263 SNARE and Associated Proteins AT4G03330 50.2 6.1e-56 215.3
Cone1ag0131 . 1 293 SNARE and Associated Proteins AT1G61290 72.7 8.3e-114 407.5
Cone5ag1736 . 1 293 SNARE and Associated Proteins AT1G61290 72.7 3.2e-113 405.6
Cone19ag0431 . 1 279 SNARE and Associated Proteins AT1G61290 63.1 5.3e-92 335.1
Cone13ag0475 . 1 279 SNARE and Associated Proteins AT1G61290 63.5 1.2e-91 334.0
Cone1ag0131 . 1 293 SNARE and Associated Proteins AT1G11250 73.0 9.1e-113 404.1
Cone5ag1736 . 1 293 SNARE and Associated Proteins AT1G11250 71.3 1.9e-110 396.4
Cone19ag0431 . 1 279 SNARE and Associated Proteins AT1G11250 63.4 3.2e-94 342.4
Cone13ag0475 . 1 279 SNARE and Associated Proteins AT1G11250 63.1 4.7e-93 338.6
Cone13ag0457 . 1 303 SNARE and Associated Proteins AT3G03800 73.6 1.5e-115 413.3
Cone3ag0557 . 1 305 SNARE and Associated Proteins AT3G03800 69.2 2.8e-109 392.5
Cone10ag0529 . 1 305 SNARE and Associated Proteins AT3G03800 66.2 3.2e-105 379.0
Cone3ag1346 . 6 281 SNARE and Associated Proteins AT3G03800 62.3 4.4e-86 315.5
Cone13ag0457 . 1 204 SNARE and Associated Proteins AT5G08080 76.0 2.1e-77 286.2
Cone3ag0557 . 1 203 SNARE and Associated Proteins AT5G08080 71.9 2.8e-74 275.8
Cone10ag0529 . 1 203 SNARE and Associated Proteins AT5G08080 67.0 7.4e-67 251.1
Cone3ag1346 . 13 180 SNARE and Associated Proteins AT5G08080 67.9 1.2e-53 207.2
Cone15ag0918 . 1 256 SNARE and Associated Proteins AT5G16830 58.6 2.3e-73 273.1
Cone12ag0481 . 1 263 SNARE and Associated Proteins AT5G16830 58.0 5.0e-73 271.9
Cone14ag0930 . 1 252 SNARE and Associated Proteins AT5G16830 57.1 4.3e-72 268.9
Cone8ag0484 . 1 262 SNARE and Associated Proteins AT5G16830 56.1 8.0e-71 264.6
Cone14ag0931 . 1 137 SNARE and Associated Proteins AT5G16830 59.7 5.3e-38 155.6
Cone8ag0484 . 1 273 SNARE and Associated Proteins AT5G46860 62.6 2.7e-76 282.7
Cone12ag0481 . 1 274 SNARE and Associated Proteins AT5G46860 62.0 4.4e-74 275.4
Cone14ag0930 . 1 252 SNARE and Associated Proteins AT5G46860 53.2 7.2e-61 231.5
Cone15ag0918 . 1 256 SNARE and Associated Proteins AT5G46860 52.7 7.2e-61 231.5
Cone14ag0931 . 1 140 SNARE and Associated Proteins AT5G46860 66.4 6.2e-44 175.3
Cone8ag0484 . 1 256 SNARE and Associated Proteins AT4G17730 58.5 3.2e-69 259.2
Cone12ag0481 . 1 257 SNARE and Associated Proteins AT4G17730 58.0 3.5e-68 255.8
Cone14ag0930 . 1 244 SNARE and Associated Proteins AT4G17730 53.0 1.4e-61 233.8
Cone15ag0918 . 1 256 SNARE and Associated Proteins AT4G17730 51.9 2.4e-61 233.0
Cone14ag0931 . 1 140 SNARE and Associated Proteins AT4G17730 66.7 5.6e-42 168.7
Cone8ag0484 . 64 255 SNARE and Associated Proteins AT1G32270 60.4 6.0e-52 202.2
Cone12ag0481 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.0e-51 201.4
Cone14ag0930 . 64 252 SNARE and Associated Proteins AT1G32270 57.7 1.1e-48 191.4
Cone15ag0918 . 64 255 SNARE and Associated Proteins AT1G32270 55.7 1.2e-47 188.0
Cone5ag0210 . 1 338 SNARE and Associated Proteins AT5G05760 68.8 1.2e-118 423.7
Cone17ag1057 . 1 335 SNARE and Associated Proteins AT3G24350 61.3 2.1e-103 373.2
Cone20ag0645 . 1 323 SNARE and Associated Proteins AT3G24350 59.7 3.0e-94 342.8
Cone3ag0826 . 1 328 SNARE and Associated Proteins AT5G26980 75.9 1.0e-125 447.2
Cone10ag0804 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 8.5e-125 444.1
Cone17ag0442 . 1 321 SNARE and Associated Proteins AT5G26980 70.9 4.1e-111 398.7
Cone20ag0971 . 1 223 SNARE and Associated Proteins AT5G26980 53.1 3.1e-50 196.4
Cone17ag0442 . 1 319 SNARE and Associated Proteins AT4G02195 68.2 1.6e-110 396.7
Cone3ag0826 . 1 329 SNARE and Associated Proteins AT4G02195 66.5 5.2e-106 381.7
Cone10ag0804 . 1 328 SNARE and Associated Proteins AT4G02195 64.8 1.7e-104 376.7
Cone20ag0971 . 1 223 SNARE and Associated Proteins AT4G02195 50.4 1.3e-48 191.0
Cone3ag0826 . 1 327 SNARE and Associated Proteins AT3G05710 75.5 4.2e-127 451.8
Cone10ag0804 . 1 326 SNARE and Associated Proteins AT3G05710 75.5 4.7e-126 448.4
Cone17ag0442 . 1 319 SNARE and Associated Proteins AT3G05710 68.4 4.0e-109 392.1
Cone9ag0047 . 1 233 SNARE and Associated Proteins AT1G16240 74.2 4.9e-90 328.2
Cone6ag0041 . 1 232 SNARE and Associated Proteins AT1G16240 74.2 1.2e-88 323.6
Cone15ag1202 . 1 234 SNARE and Associated Proteins AT1G16240 63.2 2.0e-75 279.6
Cone14ag1185 . 1 189 SNARE and Associated Proteins AT1G16240 63.5 2.3e-63 239.6
Cone6ag0041 . 1 232 SNARE and Associated Proteins AT1G79590 75.1 1.3e-91 333.6
Cone9ag0047 . 1 233 SNARE and Associated Proteins AT1G79590 73.0 3.6e-89 325.5
Cone15ag1202 . 1 234 SNARE and Associated Proteins AT1G79590 63.7 2.7e-76 282.7
Cone14ag1185 . 1 189 SNARE and Associated Proteins AT1G79590 64.0 8.2e-65 244.6
Cone14ag1146 . 56 247 SNARE and Associated Proteins AT1G28490 71.4 2.5e-66 249.2
Cone15ag1164 . 13 213 SNARE and Associated Proteins AT1G28490 67.8 9.5e-66 247.3
Cone19ag1262 . 1 265 SNARE and Associated Proteins AT3G09740 81.2 1.7e-115 412.9
Cone13ag1275 . 1 265 SNARE and Associated Proteins AT3G09740 80.8 1.1e-114 410.2
Cone5ag1222 . 1 233 SNARE and Associated Proteins AT3G09740 53.1 3.3e-58 222.6
Cone13ag1275 . 1 265 SNARE and Associated Proteins AT3G45280 64.0 1.0e-86 317.4
Cone19ag1262 . 1 265 SNARE and Associated Proteins AT3G45280 63.3 1.7e-86 316.6
Cone5ag1222 . 1 230 SNARE and Associated Proteins AT3G45280 53.8 2.5e-61 233.0
Cone13ag1275 . 1 262 SNARE and Associated Proteins AT3G61450 66.8 2.9e-91 332.4
Cone19ag1262 . 1 262 SNARE and Associated Proteins AT3G61450 66.0 1.5e-90 330.1
Cone11ag1168 . 65 309 SNARE and Associated Proteins AT1G51740 76.4 1.7e-96 349.7
Cone18ag0421 . 65 309 SNARE and Associated Proteins AT1G51740 76.8 6.4e-96 347.8
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002433 5 3 5 4 2 1 2 1 2 2 1 1 2 1 2 1 1 3 2 1 2 3 2 2 1 1 1 2 1 4 61