Gene search
Sequence information
| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Cone7ag1712 | ATGAATAGGCCAGGGGATTGGAATTGCAGGTCGTGCAACCATTTGAACTTCCAAAGGAGGGAATCCTGTCAACGCTGCGGCGACCCGAGATCCGGCAGCGGTGGGGGCGATTTTGGAAGTTTCGGCGGGAGAGGTACTGGAGTGTTCGGCAGTACGGGACCAGACGTGCGTCCAGGGGACTGGTACTGCTCTTTGGGCAACTGTGGGACCCATAACTTTGCTAGCCGCTCTAGCTGCTTCAAGTGCGGTGCTTCCAAGGACGACTCCTCTGCCACTCACGATGGAGATATGCCCCGCCTGAGAGTTTTCGGAGGCTTCGGCTCTTCGGCCAGTACTAGCCGCTCCGGCTGGAAATCCGGTGACTGGATTTGCACCAGAGCGGGATGCAATGAGCACAACTTTGCTATCCGGATGGAGTGCTACAGATGCAATGCCCCAAGGGACTCTACGGCCAAGCTCACCTAA | 465 | 57.2 | MNRPGDWNCRSCNHLNFQRRESCQRCGDPRSGSGGGDFGSFGGRGTGVFGSTGPDVRPGDWYCSLGNCGTHNFASRSSCFKCGASKDDSSATHDGDMPRLRVFGGFGSSASTSRSGWKSGDWICTRAGCNEHNFAIRMECYRCNAPRDSTAKLT | 154 |
Gff information
| Chromosome | Start | End | Strand | Old_gene | Gene | Num |
|---|---|---|---|---|---|---|
| 7 | 11390635 | 11391719 | - | Conep07aG0176500.1 | Cone7ag1712 | 442308 |
Annotation
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Cone7ag1712 | 154 | FunFam | Ran-binding zinc finger protein | 111 | 149 | - | - | |
| Cone7ag1712 | 154 | ProSitePatterns | Zinc finger RanBP2-type signature. | 122 | 143 | IPR001876 | - | |
| Cone7ag1712 | 154 | ProSitePatterns | Zinc finger RanBP2-type signature. | 61 | 82 | IPR001876 | - | |
| Cone7ag1712 | 154 | PANTHER | ZINC FINGER PROTEIN | 53 | 151 | - | GO:0003729(PANTHER)|GO:0005737(PANTHER) | |
| Cone7ag1712 | 154 | ProSiteProfiles | Zinc finger RanBP2 type profile. | 3 | 32 | IPR001876 | - | |
| Cone7ag1712 | 154 | SMART | zf_4 | 120 | 146 | IPR001876 | - | |
| Cone7ag1712 | 154 | SMART | zf_4 | 59 | 85 | IPR001876 | - | |
| Cone7ag1712 | 154 | SMART | zf_4 | 5 | 29 | IPR001876 | - | |
| Cone7ag1712 | 154 | SUPERFAMILY | Ran binding protein zinc finger-like | 110 | 150 | IPR036443 | - | |
| Cone7ag1712 | 154 | ProSitePatterns | Zinc finger RanBP2-type signature. | 7 | 26 | IPR001876 | - | |
| Cone7ag1712 | 154 | ProSiteProfiles | Zinc finger RanBP2 type profile. | 57 | 88 | IPR001876 | - | |
| Cone7ag1712 | 154 | FunFam | Ran-binding zinc finger protein | 51 | 88 | - | - | |
| Cone7ag1712 | 154 | SUPERFAMILY | Ran binding protein zinc finger-like | 2 | 32 | IPR036443 | - | |
| Cone7ag1712 | 154 | ProSiteProfiles | Zinc finger RanBP2 type profile. | 118 | 149 | IPR001876 | - | |
| Cone7ag1712 | 154 | SUPERFAMILY | Ran binding protein zinc finger-like | 50 | 89 | IPR036443 | - | |
| Cone7ag1712 | 154 | Pfam | Zn-finger in Ran binding protein and others | 118 | 147 | IPR001876 | - | |
| Cone7ag1712 | 154 | Pfam | Zn-finger in Ran binding protein and others | 57 | 86 | IPR001876 | - | |
| Cone7ag1712 | 154 | Pfam | Zn-finger in Ran binding protein and others | 3 | 31 | IPR001876 | - | |
| Cone7ag1712 | 154 | Gene3D | - | 108 | 150 | - | - | |
| Cone7ag1712 | 154 | Gene3D | - | 2 | 32 | - | - | |
| Cone7ag1712 | 154 | Gene3D | - | 53 | 88 | - | - |
Pathway
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Cone7ag1712 | - | - | - | - | 0.0 |
Dupl-types
| Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
|---|---|---|---|---|---|---|
| Cone16ag0666 | Cone-Chr16:8069791 | Cone7ag1712 | Cone-Chr7:11390635 | 2.09E-70 | wgd | |
| Cone2ag0354 | Cone-Chr2:1872167 | Cone7ag1712 | Cone-Chr7:11390635 | 3.36E-72 | wgd | |
| Cone4ag1804 | Cone-Chr4:13092217 | Cone7ag1712 | Cone-Chr7:11390635 | 3.08E-108 | wgd | |
| Cone4ag0684 | Cone-Chr4:3425451 | Cone7ag1712 | Cone-Chr7:11390635 | 7.40E-43 | wgd | |
| Cone7ag0645 | Cone-Chr7:3313300 | Cone7ag1712 | Cone-Chr7:11390635 | 9.10E-44 | wgd |
Deco-Alignment
| Select | Vvi1 | Blo1 | Blo2 | Bda1 | Bda2 | Bpe1 | Bpe2 | Bma1 | Bma2 | Cmo1 | Cmo2 | Cma1 | Cma2 | Car1 | Car2 | Sed1 | Cpe1 | Cpe2 | Bhi1 | Tan1 | Cmetu1 | Lac1 | Hepe1 | Mch1 | Lcy1 | Cla1 | Cam1 | Cec1 | Cco1 | Clacu1 | Cmu1 | Cre1 | Cone1 | Cone2 | Cone3 | Cone4 | Lsi1 | Csa1 | Chy1 | Cme1 | Blo3 | Blo4 | Bda3 | Bda4 | Bpe3 | Bpe4 | Bma3 | Bma4 | Sed2 | Cmo3 | Cmo4 | Cma3 | Cma4 | Car3 | Car4 | Cpe3 | Cpe4 | Bhi2 | Tan2 | Cmetu2 | Lac2 | Hepe2 | Mch2 | Lcy2 | Cla2 | Cam2 | Cec2 | Cco2 | Clacu2 | Cmu2 | Cre2 | Lsi2 | Csa2 | Chy2 | Cme2 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Vvi4g452 | Blo01g01377 | . | Bda01g00734 | . | . | Bpe02g00572 | . | . | Cmo05g00409 | Cmo12g00277 | . | Cma05g00396 | . | Car12g00309 | Sed01g1363 | Cpe07g00286 | . | Bhi04g00986 | Tan02g2707 | Cmetu03g1356 | . | . | . | Lcy13g1766 | . | . | . | . | . | . | . | Cone4ag1804 | Cone7ag1712 | . | . | . | . | . | Cme03g01640 | . | . | . | . | . | . | . | . | . | . | . | . | Cma12g00327 | . | Car05g00333 | Cpe11g00340 | . | . | . | . | . | . | . | . | Cla08g01315 | Cam08g1775 | Cec08g1357 | Cco08g1477 | Clacu08g1471 | . | Cre08g1258 | Lsi08g01180 | . | Chy03g01140 | . |
Syn-Orthogroups
| Select | Orthogroup | Bda | Bhi | Blo | Bma | Bpe | Cam | Car | Cco | Cec | Chy | Cla | Clacu | Cma | Cme | Cmetu | Cmo | Cmu | Cone | Cpe | Cre | Csa | HCH | Hepe | Lac | Lcy | Lsi | Mch | Sed | Tan | Vvi | Total |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| OG0001025 | 2 | 6 | 2 | 1 | 2 | 1 | 5 | 2 | 2 | 2 | 1 | 1 | 4 | 3 | 3 | 5 | 2 | 4 | 4 | 1 | 2 | 3 | 3 | 2 | 3 | 2 | 3 | 5 | 5 | 2 | 83 |