Gene search
Sequence information
| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Cone9ag0052 | ATGCAAGATAAAGCTCTACGCTCCTATGCAGAAATGCAGAACGTCATGGACCGGACAAGGCGTGAAGCAGAAAATGCAAAAAAGTTTGCCATTCAGAATTTTGCAAAGGGTTTGCTAGATGTTTCAGACAACTTGGGGAGAGCCTCTTCAGTTGTCAAAGAGAGTTTCTCAAAAATTGATTTATCGGAGGACTCTAGTGGAGCCGTGCCTTTCCTTAAAACGCTTCTACAAGGTGTTGAAATGACTGAGAAACAACTGGGCGAGGTGTTTAGGAAGTTTGGAGTCGAAAAATTTGATCCAACAAATGAGCCATTTGACCCACATAGGCATAATGCAGTATTTCAAATACCCGATGCTTCTAAGCCTCCAGGCACTGTTGCTGTTATCCTCAAGTGTGGATACATGCTTTATGATAGAGTAGTTAGGCCGGCAGAAGTTGGTGTGAGTCAAGCTGTTAGGAGCGATGCAGATGAGAATAAGGAGAGCATGACATCAGACAAGGACTCTCAAGGTTGA | 516 | 43.6 | MQDKALRSYAEMQNVMDRTRREAENAKKFAIQNFAKGLLDVSDNLGRASSVVKESFSKIDLSEDSSGAVPFLKTLLQGVEMTEKQLGEVFRKFGVEKFDPTNEPFDPHRHNAVFQIPDASKPPGTVAVILKCGYMLYDRVVRPAEVGVSQAVRSDADENKESMTSDKDSQG | 171 |
Gff information
| Chromosome | Start | End | Strand | Old_gene | Gene | Num |
|---|---|---|---|---|---|---|
| 9 | 262621 | 264719 | - | Conep09aG0005200.1 | Cone9ag0052 | 444215 |
Annotation
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Cone9ag0052 | 171 | MobiDBLite | consensus disorder prediction | 154 | 171 | - | - | |
| Cone9ag0052 | 171 | Pfam | GrpE | 1 | 150 | IPR000740 | GO:0000774(InterPro)|GO:0006457(InterPro)|GO:0042803(InterPro)|GO:0051087(InterPro) | |
| Cone9ag0052 | 171 | CDD | GrpE | 1 | 148 | IPR000740 | GO:0000774(InterPro)|GO:0006457(InterPro)|GO:0042803(InterPro)|GO:0051087(InterPro) | |
| Cone9ag0052 | 171 | Gene3D | - | 1 | 93 | IPR013805 | - | |
| Cone9ag0052 | 171 | SUPERFAMILY | Head domain of nucleotide exchange factor GrpE | 95 | 150 | IPR009012 | GO:0006457(InterPro) | |
| Cone9ag0052 | 171 | PRINTS | GrpE protein signature | 102 | 117 | IPR000740 | GO:0000774(InterPro)|GO:0006457(InterPro)|GO:0042803(InterPro)|GO:0051087(InterPro) | |
| Cone9ag0052 | 171 | PRINTS | GrpE protein signature | 6 | 22 | IPR000740 | GO:0000774(InterPro)|GO:0006457(InterPro)|GO:0042803(InterPro)|GO:0051087(InterPro) | |
| Cone9ag0052 | 171 | PRINTS | GrpE protein signature | 129 | 148 | IPR000740 | GO:0000774(InterPro)|GO:0006457(InterPro)|GO:0042803(InterPro)|GO:0051087(InterPro) | |
| Cone9ag0052 | 171 | MobiDBLite | consensus disorder prediction | 148 | 171 | - | - | |
| Cone9ag0052 | 171 | Hamap | Protein GrpE [grpE]. | 2 | 150 | IPR000740 | GO:0000774(InterPro)|GO:0006457(InterPro)|GO:0042803(InterPro)|GO:0051087(InterPro) | |
| Cone9ag0052 | 171 | ProSitePatterns | grpE protein signature. | 105 | 148 | IPR000740 | GO:0000774(InterPro)|GO:0006457(InterPro)|GO:0042803(InterPro)|GO:0051087(InterPro) | |
| Cone9ag0052 | 171 | FunFam | GrpE protein homolog | 1 | 93 | - | - | |
| Cone9ag0052 | 171 | SUPERFAMILY | Coiled-coil domain of nucleotide exchange factor GrpE | 2 | 94 | IPR013805 | - | |
| Cone9ag0052 | 171 | Gene3D | Head domain of nucleotide exchange factor GrpE | 94 | 150 | IPR009012 | GO:0006457(InterPro) | |
| Cone9ag0052 | 171 | PANTHER | GRPE PROTEIN | 1 | 150 | IPR000740 | GO:0000774(InterPro)|GO:0000774(PANTHER)|GO:0001405(PANTHER)|GO:0006457(InterPro)|GO:0030150(PANTHER)|GO:0042803(InterPro)|GO:0051082(PANTHER)|GO:0051087(InterPro) | |
| Cone9ag0052 | 171 | Coils | Coil | 9 | 29 | - | - | |
| Cone9ag0052 | 171 | FunFam | GrpE protein homolog | 94 | 150 | - | - |
Pathway
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Cone9ag0052 | K03687 | - | - | vvi:100252150 | 261.536 |
Dupl-types
| Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
|---|---|---|---|---|---|---|
| Cone9ag0052 | Cone-Chr9:262621 | Cone20ag0485 | Cone-Chr20:2591413 | 1.27E-06 | dispersed | |
| Cone14ag1179 | Cone-Chr14:9647390 | Cone9ag0052 | Cone-Chr9:262621 | 1.48E-86 | wgd | |
| Cone15ag1191 | Cone-Chr15:9551535 | Cone9ag0052 | Cone-Chr9:262621 | 1.29E-85 | wgd | |
| Cone6ag0044 | Cone-Chr6:264119 | Cone9ag0052 | Cone-Chr9:262621 | 1.19E-100 | wgd |
Deco-Alignment
| Select | Vvi1 | Blo1 | Blo2 | Bda1 | Bda2 | Bpe1 | Bpe2 | Bma1 | Bma2 | Cmo1 | Cmo2 | Cma1 | Cma2 | Car1 | Car2 | Sed1 | Cpe1 | Cpe2 | Bhi1 | Tan1 | Cmetu1 | Lac1 | Hepe1 | Mch1 | Lcy1 | Cla1 | Cam1 | Cec1 | Cco1 | Clacu1 | Cmu1 | Cre1 | Cone1 | Cone2 | Cone3 | Cone4 | Lsi1 | Csa1 | Chy1 | Cme1 | Blo3 | Blo4 | Bda3 | Bda4 | Bpe3 | Bpe4 | Bma3 | Bma4 | Sed2 | Cmo3 | Cmo4 | Cma3 | Cma4 | Car3 | Car4 | Cpe3 | Cpe4 | Bhi2 | Tan2 | Cmetu2 | Lac2 | Hepe2 | Mch2 | Lcy2 | Cla2 | Cam2 | Cec2 | Cco2 | Clacu2 | Cmu2 | Cre2 | Lsi2 | Csa2 | Chy2 | Cme2 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Vvi19g571 | . | . | . | . | Bpe09g00153 | . | Bma10g00576 | Bma13g01078 | Cmo16g00946 | Cmo06g00893 | . | Cma09g00968 | . | Car09g00883 | Sed04g3701 | Cpe06g00783 | . | Bhi09g01692 | Tan01g3121 | Cmetu01g0613 | . | Hepe01g1250 | Mch11g1215 | . | Cla10g00480 | Cam10g0467 | Cec10g0487 | Cco10g0475 | Clacu10g0487 | Cmu10g1315 | Cre10g0720 | Cone6ag0044 | Cone9ag0052 | Cone14ag1179 | Cone15ag1191 | Lsi02g01882 | Csa03g00481 | . | Cme06g02842 | Blo07g00884 | Blo10g00848 | Bda05g00699 | Bda12g00933 | . | Bpe03g00773 | . | . | Sed08g2981 | . | Cmo09g00969 | . | Cma16g00911 | . | Car16g00885 | Cpe14g00736 | . | Bhi11g00582 | Tan01g1745 | Cmetu06g0127 | . | Hepe06g0017 | . | . | Cla09g01032 | Cam09g1087 | Cec09g1086 | Cco09g1107 | . | . | Cre09g1052 | Lsi05g00568 | . | Chy06g01841 | . |
Syn-Orthogroups
| Select | Orthogroup | Bda | Bhi | Blo | Bma | Bpe | Cam | Car | Cco | Cec | Chy | Cla | Clacu | Cma | Cme | Cmetu | Cmo | Cmu | Cone | Cpe | Cre | Csa | HCH | Hepe | Lac | Lcy | Lsi | Mch | Sed | Tan | Vvi | Total |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| OG0002397 | 2 | 2 | 2 | 3 | 2 | 2 | 3 | 2 | 2 | 1 | 2 | 2 | 2 | 1 | 2 | 2 | 2 | 4 | 2 | 2 | 1 | 1 | 2 | 2 | 2 | 2 | 3 | 2 | 3 | 1 | 61 |