Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cone9ag0914 ATGGCTGCTTCAACAATGGCTCTCTCTTCCCCATCATTTGCCGGACAGGCAGTAAAGCTCGCTCCCTCCGGCTCGGACATCCTCGGAAACGGTAGAGTCAGCATGAGGAAAACCGCTACCAAGAAAGTTGTTTCCTCAGGAAGCCCATGGTACGGCCCAGACCGTGTTAAGTACTTGGGCCCATTCTCTGGCGAGGCTCCATCTTACCTTACCGGAGAATTCCCCGGTGACTACGGCTGGGACACCGCCGGGCTTTCGGCCGACCCAGAGACATTCGCCAAGAACCGTGAGCTTGAAGTGATCCATTCAAGATGGGCCATGCTTGGTGCTCTTGGATGCGTCTTCCCTGAGCTCTTGGCCCGCAACGGTGTGAAGTTCGGTGAGGCCGTGTGGTTCAAGGCCGGAGCTCAAATCTTCAGTGAAGGTGGACTCGACTACTTGGGCAACCCCAGCTTGATCCACGCCCAAAGCATCTTAGCAATTTGGGCCACACAGGTGATCTTGATGGGCGCGGTTGAGGGGTACCGTGTTGCAGGTGGGCCACTTGGAGAAGTGACCGACCCACTATACCCGGGTGGAAGCTTTGATCCACTGGGCCTTGCTGAAGATCCAGAGGCTTTTGCTGAGTTGAAGGTGAAGGAGCTGAAGAATGGAAGACTAGCCATGTTTTCTATGTTTGGATTCTTCGTACAAGCTATTGTGACAGGAAAGGGCCCACTAGAGAATCTCGCCGACCACCTTGCCGACCCGGTCAGCAACAACGCATGGGCCTACGCCACAAACTTTGTGCCCGGAAAATGA 801 55.06 MAASTMALSSPSFAGQAVKLAPSGSDILGNGRVSMRKTATKKVVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 266
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
9 4485407 4486207 + Conep09aG0093700.1 Cone9ag0914 445077

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cone9ag0914 266 Pfam Chlorophyll A-B binding protein 66 233 IPR022796 -
Cone9ag0914 266 SUPERFAMILY Chlorophyll a-b binding protein 49 263 - -
Cone9ag0914 266 Gene3D Chlorophyll a/b binding protein domain 57 259 - -
Cone9ag0914 266 FunFam Chlorophyll a-b binding protein, chloroplastic 57 259 - -
Cone9ag0914 266 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 4 266 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0009941(PANTHER)|GO:0010287(PANTHER)|GO:0016020(InterPro)
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cone9ag0914 K08912 - - mdm:103419710 512.686
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cone1ag0250 Cone-Chr1:1666782 Cone9ag0914 Cone-Chr9:4485407 7.67E-178 dispersed
Cone3ag1486 Cone-Chr3:33523763 Cone9ag0914 Cone-Chr9:4485407 4.51E-186 dispersed
Cone6ag0906 Cone-Chr6:4652083 Cone9ag0914 Cone-Chr9:4485407 1.92E-191 dispersed
Cone9ag0912 Cone-Chr9:4480977 Cone9ag0914 Cone-Chr9:4485407 3.08E-195 proximal
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cone11ag1248 . 1 455 Chloroplast and Mitochondria Gene Families AT2G28800 62.6 3.8e-144 508.8
Cone18ag0342 . 1 457 Chloroplast and Mitochondria Gene Families AT2G28800 62.2 8.4e-144 507.7
Cone13ag1100 . 78 412 Chloroplast and Mitochondria Gene Families AT2G28800 58.2 2.4e-98 356.7
Cone19ag1088 . 77 413 Chloroplast and Mitochondria Gene Families AT2G28800 57.8 2.7e-97 353.2
Cone10ag0924 . 3 257 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 1.2e-121 433.3
Cone3ag0950 . 3 257 Chloroplast and Mitochondria Gene Families AT1G15820 82.0 9.6e-119 423.7
Cone8ag1383 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.8 5.8e-144 507.7
Cone6ag0906 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.9 3.1e-121 432.2
Cone9ag0912 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.6 4.1e-121 431.8
Cone9ag0914 . 2 266 Chloroplast and Mitochondria Gene Families AT3G27690 77.6 4.1e-121 431.8
Cone3ag1486 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 76.8 2.0e-120 429.5
Cone1ag0250 . 1 267 Chloroplast and Mitochondria Gene Families AT3G27690 74.1 9.4e-118 420.6
Cone9ag0132 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 68.1 6.3e-98 354.8
Cone6ag0112 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 66.3 7.7e-96 347.8
Cone11ag1332 . 115 341 Chloroplast and Mitochondria Gene Families AT3G27690 51.5 4.3e-54 209.1
Cone4ag0090 . 62 274 Chloroplast and Mitochondria Gene Families AT3G27690 52.8 2.1e-53 206.8
Cone7ag0081 . 111 323 Chloroplast and Mitochondria Gene Families AT3G27690 52.3 8.1e-53 204.9
Cone3ag1170 . 2 160 Chloroplast and Mitochondria Gene Families AT3G27690 61.4 5.2e-52 202.2
Cone13ag0367 . 6 265 Chloroplast and Mitochondria Gene Families AT3G61470 82.4 8.6e-128 453.8
Cone12ag0808 . 1 268 Chloroplast and Mitochondria Gene Families AT3G61470 78.4 3.4e-124 441.8
Cone8ag0754 . 1 268 Chloroplast and Mitochondria Gene Families AT3G61470 78.0 9.9e-124 440.3
Cone4ag0830 . 66 271 Chloroplast and Mitochondria Gene Families AT3G61470 68.9 2.1e-86 316.2
Cone2ag0840 . 22 247 Chloroplast and Mitochondria Gene Families AT3G61470 51.3 1.8e-64 243.4
Cone16ag0175 . 22 246 Chloroplast and Mitochondria Gene Families AT3G61470 51.7 3.9e-64 242.3
Cone5ag0333 . 1 197 Chloroplast and Mitochondria Gene Families AT3G54890 83.8 7.5e-93 337.4
Cone1ag1346 . 1 199 Chloroplast and Mitochondria Gene Families AT3G54890 83.0 2.4e-91 332.4
Cone3ag0419 . 3 288 Chloroplast and Mitochondria Gene Families AT3G08940 83.6 3.0e-137 485.3
Cone10ag0383 . 3 288 Chloroplast and Mitochondria Gene Families AT3G08940 83.3 6.6e-137 484.2
Cone1ag1220 . 61 334 Chloroplast and Mitochondria Gene Families AT3G08940 71.3 1.0e-105 380.6
Cone11ag1332 . 27 345 Chloroplast and Mitochondria Gene Families AT1G76570 77.1 8.9e-146 513.8
Cone18ag0141 . 1 271 Chloroplast and Mitochondria Gene Families AT1G61520 84.1 2.0e-130 462.6
Cone11ag1448 . 1 271 Chloroplast and Mitochondria Gene Families AT1G61520 83.7 9.8e-130 460.3
Cone8ag1383 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 5.2e-144 507.7
Cone9ag0912 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.6e-121 433.0
Cone9ag0914 . 5 266 Chloroplast and Mitochondria Gene Families AT2G05070 78.7 1.6e-121 433.0
Cone6ag0906 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.4 2.8e-121 432.2
Cone3ag1486 . 5 267 Chloroplast and Mitochondria Gene Families AT2G05070 79.5 8.1e-121 430.6
Cone1ag0250 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 75.7 1.1e-117 420.2
Cone9ag0132 . 11 264 Chloroplast and Mitochondria Gene Families AT2G05070 69.6 2.5e-98 355.9
Cone6ag0112 . 11 264 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 9.0e-96 347.4
Cone4ag0090 . 62 274 Chloroplast and Mitochondria Gene Families AT2G05070 53.2 1.4e-53 207.2
Cone7ag0081 . 111 323 Chloroplast and Mitochondria Gene Families AT2G05070 52.8 5.5e-53 205.3
Cone11ag1332 . 115 338 Chloroplast and Mitochondria Gene Families AT2G05070 50.9 1.6e-52 203.8
Cone3ag1170 . 5 160 Chloroplast and Mitochondria Gene Families AT2G05070 61.4 2.1e-52 203.4
Cone8ag1383 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.0 2.2e-125 446.0
Cone9ag0912 . 5 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.6 2.0e-102 369.8
Cone9ag0914 . 5 238 Chloroplast and Mitochondria Gene Families AT2G05100 76.6 2.0e-102 369.8
Cone6ag0906 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 4.5e-102 368.6
Cone3ag1486 . 5 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.3 2.9e-101 365.9
Cone1ag0250 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 73.1 2.1e-99 359.8
Cone9ag0132 . 11 236 Chloroplast and Mitochondria Gene Families AT2G05100 68.9 2.3e-82 303.1
Cone6ag0112 . 11 236 Chloroplast and Mitochondria Gene Families AT2G05100 66.8 6.3e-80 295.0
Cone3ag1170 . 5 160 Chloroplast and Mitochondria Gene Families AT2G05100 62.0 2.5e-52 203.4
Cone4ag0090 . 62 258 Chloroplast and Mitochondria Gene Families AT2G05100 52.0 5.0e-45 179.1
Cone7ag0081 . 111 307 Chloroplast and Mitochondria Gene Families AT2G05100 51.5 1.9e-44 177.2
Cone1ag1220 . 63 233 Chloroplast and Mitochondria Gene Families AT2G40100 68.2 1.5e-65 246.5
Cone3ag0419 . 4 170 Chloroplast and Mitochondria Gene Families AT2G40100 68.6 9.8e-65 243.8
Cone10ag0383 . 4 170 Chloroplast and Mitochondria Gene Families AT2G40100 67.4 3.5e-62 235.3
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 1.2e-137 486.5
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 89.1 1.2e-137 486.5
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 2.3e-136 482.3
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.1 3.1e-136 481.9
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT1G29930 86.1 1.3e-131 466.5
Cone8ag1383 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 77.5 1.8e-115 412.9
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29930 71.1 4.5e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29930 70.2 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT1G29930 72.9 2.9e-62 236.1
Cone4ag0090 . 71 274 Chloroplast and Mitochondria Gene Families AT1G29930 54.2 5.9e-55 211.8
Cone7ag0081 . 110 323 Chloroplast and Mitochondria Gene Families AT1G29930 52.7 7.7e-55 211.5
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 4.7e-137 484.6
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 88.8 4.7e-137 484.6
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 8.9e-136 480.3
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 87.7 1.2e-135 479.9
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT1G29920 85.7 5.1e-131 464.5
Cone8ag1383 . 33 265 Chloroplast and Mitochondria Gene Families AT1G29920 83.5 3.0e-115 412.1
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29920 71.1 4.5e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29920 70.2 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT1G29920 72.3 1.1e-61 234.2
Cone4ag0090 . 71 274 Chloroplast and Mitochondria Gene Families AT1G29920 54.2 5.9e-55 211.8
Cone7ag0081 . 110 323 Chloroplast and Mitochondria Gene Families AT1G29920 52.7 7.7e-55 211.5
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 4.7e-137 484.6
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 88.8 4.7e-137 484.6
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 8.9e-136 480.3
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 87.7 1.2e-135 479.9
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT1G29910 85.7 5.1e-131 464.5
Cone8ag1383 . 33 265 Chloroplast and Mitochondria Gene Families AT1G29910 83.5 3.0e-115 412.1
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29910 71.1 4.5e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT1G29910 70.2 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT1G29910 72.3 1.1e-61 234.2
Cone4ag0090 . 71 274 Chloroplast and Mitochondria Gene Families AT1G29910 54.2 5.9e-55 211.8
Cone7ag0081 . 110 323 Chloroplast and Mitochondria Gene Families AT1G29910 52.7 7.7e-55 211.5
Cone4ag0090 . 11 289 Chloroplast and Mitochondria Gene Families AT4G10340 87.5 3.3e-141 498.4
Cone7ag0081 . 58 338 Chloroplast and Mitochondria Gene Families AT4G10340 85.1 1.8e-139 492.7
Cone6ag0906 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 5.1e-57 218.8
Cone9ag0912 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 5.1e-57 218.8
Cone9ag0914 . 50 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.5 5.1e-57 218.8
Cone3ag1486 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.5e-56 217.2
Cone1ag0250 . 39 255 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 7.3e-56 214.9
Cone8ag1383 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 2.8e-55 213.0
Cone9ag0132 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 51.9 2.4e-51 199.9
Cone6ag0112 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 51.9 4.2e-51 199.1
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 89.1 5.2e-136 481.1
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34420 89.1 5.2e-136 481.1
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 89.1 4.4e-135 478.0
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.1 1.3e-134 476.5
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT2G34420 86.5 2.5e-130 462.2
Cone8ag1383 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 76.0 1.3e-115 413.3
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34420 71.5 4.4e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34420 70.7 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT2G34420 72.3 2.7e-60 229.6
Cone7ag0081 . 110 323 Chloroplast and Mitochondria Gene Families AT2G34420 51.8 3.8e-54 209.1
Cone9ag0912 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 5.8e-135 477.6
Cone9ag0914 . 1 266 Chloroplast and Mitochondria Gene Families AT2G34430 88.0 5.8e-135 477.6
Cone6ag0906 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.2 1.3e-134 476.5
Cone3ag1486 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 87.3 1.1e-133 473.4
Cone1ag0250 . 4 267 Chloroplast and Mitochondria Gene Families AT2G34430 86.0 3.9e-131 464.9
Cone8ag1383 . 30 265 Chloroplast and Mitochondria Gene Families AT2G34430 82.8 2.5e-114 409.1
Cone9ag0132 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 72.2 4.5e-95 345.1
Cone6ag0112 . 34 264 Chloroplast and Mitochondria Gene Families AT2G34430 71.4 1.4e-93 340.1
Cone3ag1170 . 1 153 Chloroplast and Mitochondria Gene Families AT2G34430 72.7 6.5e-62 235.0
Cone4ag0090 . 71 274 Chloroplast and Mitochondria Gene Families AT2G34430 53.3 3.8e-54 209.1
Cone7ag0081 . 120 323 Chloroplast and Mitochondria Gene Families AT2G34430 53.3 8.5e-54 208.0
Cone3ag0419 . 1 288 Chloroplast and Mitochondria Gene Families AT5G01530 83.8 4.2e-139 491.5
Cone10ag0383 . 1 288 Chloroplast and Mitochondria Gene Families AT5G01530 83.2 1.0e-137 486.9
Cone1ag1220 . 61 334 Chloroplast and Mitochondria Gene Families AT5G01530 72.7 8.6e-108 387.5
Cone18ag1406 . 42 301 Chloroplast and Mitochondria Gene Families AT5G40810 91.5 2.4e-141 498.8
Cone11ag0071 . 350 609 Chloroplast and Mitochondria Gene Families AT5G40810 91.2 5.8e-140 494.2
Cone11ag0071 . 301 609 Chloroplast and Mitochondria Gene Families AT3G27240 84.5 7.3e-150 527.3
Cone18ag1406 . 30 301 Chloroplast and Mitochondria Gene Families AT3G27240 90.1 3.0e-143 505.4
Cone5ag1055 . 1 324 Chloroplast and Mitochondria Gene Families AT2G30160 73.3 1.0e-141 500.4
Cone1ag0764 . 5 185 Chloroplast and Mitochondria Gene Families AT2G30160 69.4 3.6e-70 262.7
Cone5ag1055 . 1 324 Chloroplast and Mitochondria Gene Families AT1G07030 73.1 3.3e-140 495.4
Cone1ag0764 . 1 185 Chloroplast and Mitochondria Gene Families AT1G07030 65.1 4.1e-66 249.2
Cone20ag0967 . 7 316 Chloroplast and Mitochondria Gene Families AT2G47490 77.1 1.5e-137 486.5
Cone17ag0445 . 1 315 Chloroplast and Mitochondria Gene Families AT2G47490 73.3 2.0e-134 476.1
Cone9ag0448 . 24 324 Chloroplast and Mitochondria Gene Families AT2G47490 62.0 1.4e-108 390.2
Cone6ag0430 . 24 326 Chloroplast and Mitochondria Gene Families AT2G47490 61.2 7.0e-108 387.9
Cone9ag0448 . 25 373 Chloroplast and Mitochondria Gene Families AT1G25380 63.1 7.6e-122 434.5
Cone6ag0430 . 32 375 Chloroplast and Mitochondria Gene Families AT1G25380 64.0 4.2e-120 428.7
Cone20ag0967 . 10 302 Chloroplast and Mitochondria Gene Families AT1G25380 66.1 8.8e-110 394.4
Cone17ag0445 . 9 301 Chloroplast and Mitochondria Gene Families AT1G25380 64.7 1.3e-108 390.6
Cone6ag1051 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 73.2 3.2e-255 878.2
Cone9ag1046 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 72.9 1.9e-252 869.0
Cone12ag1430 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 68.5 3.8e-240 828.2
Cone8ag1493 . 5 576 Chloroplast and Mitochondria Gene Families AT4G21490 65.7 1.7e-224 776.2
Cone12ag1429 . 7 573 Chloroplast and Mitochondria Gene Families AT4G21490 66.1 8.5e-224 773.9
Cone20ag1320 . 22 187 Chloroplast and Mitochondria Gene Families AT1G17530 68.5 1.6e-59 226.5
Cone17ag0084 . 22 187 Chloroplast and Mitochondria Gene Families AT1G17530 66.1 3.3e-57 218.8
Cone20ag1320 . 1 191 Chloroplast and Mitochondria Gene Families AT3G04800 51.0 1.3e-43 173.7
Cone17ag0084 . 22 191 Chloroplast and Mitochondria Gene Families AT3G04800 52.6 1.5e-41 166.8
Cone20ag1320 . 22 191 Chloroplast and Mitochondria Gene Families AT1G72750 69.4 4.6e-62 235.0
Cone17ag0084 . 22 191 Chloroplast and Mitochondria Gene Families AT1G72750 68.2 1.1e-60 230.3
Cone6ag0477 . 1 168 Chloroplast and Mitochondria Gene Families AT1G26100 66.1 1.2e-56 217.2
Cone11ag0327 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 72.7 7.3e-94 340.9
Cone14ag0090 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 73.5 9.2e-83 304.3
Cone15ag0096 . 23 206 Chloroplast and Mitochondria Gene Families AT4G25570 66.3 1.5e-72 270.4
Cone9ag0373 . 1 224 Chloroplast and Mitochondria Gene Families AT1G14730 58.5 1.2e-69 260.4
Cone6ag0339 . 4 225 Chloroplast and Mitochondria Gene Families AT1G14730 58.1 1.0e-68 257.3
Cone11ag0021 . 9 367 Chloroplast and Mitochondria Gene Families AT5G14040 80.9 3.3e-168 588.6
Cone18ag1459 . 8 361 Chloroplast and Mitochondria Gene Families AT5G14040 79.2 4.4e-165 578.2
Cone19ag0236 . 54 362 Chloroplast and Mitochondria Gene Families AT5G14040 78.2 4.3e-144 508.4
Cone10ag1210 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 52.7 2.0e-88 323.6
Cone18ag1459 . 10 361 Chloroplast and Mitochondria Gene Families AT3G48850 71.7 1.6e-143 506.5
Cone11ag0021 . 11 365 Chloroplast and Mitochondria Gene Families AT3G48850 70.6 1.5e-141 500.0
Cone19ag0236 . 55 362 Chloroplast and Mitochondria Gene Families AT3G48850 76.6 5.3e-139 491.5
Cone10ag1210 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 52.6 4.7e-87 318.9
Cone10ag1210 . 8 308 Chloroplast and Mitochondria Gene Families AT2G17270 74.2 1.4e-132 469.9
Cone11ag0021 . 63 363 Chloroplast and Mitochondria Gene Families AT2G17270 53.2 1.4e-87 320.5
Cone18ag1459 . 63 364 Chloroplast and Mitochondria Gene Families AT2G17270 51.7 1.2e-86 317.4
Cone18ag1144 . 16 317 Chloroplast and Mitochondria Gene Families AT5G15640 79.6 4.0e-135 478.4
Cone11ag0356 . 16 317 Chloroplast and Mitochondria Gene Families AT5G15640 78.3 2.9e-133 472.2
Cone15ag0699 . 12 318 Chloroplast and Mitochondria Gene Families AT5G15640 52.8 1.8e-82 303.5
Cone7ag1604 . 13 348 Chloroplast and Mitochondria Gene Families AT5G26200 65.5 4.4e-119 425.2
Cone4ag1686 . 13 348 Chloroplast and Mitochondria Gene Families AT5G26200 64.0 3.5e-116 415.6
Cone7ag1234 . 14 343 Chloroplast and Mitochondria Gene Families AT5G26200 61.7 9.7e-111 397.5
Cone7ag1234 . 7 345 Chloroplast and Mitochondria Gene Families AT1G72820 69.9 1.2e-132 470.3
Cone7ag1604 . 1 349 Chloroplast and Mitochondria Gene Families AT1G72820 64.3 7.8e-124 441.0
Cone4ag1686 . 1 349 Chloroplast and Mitochondria Gene Families AT1G72820 63.3 1.1e-120 430.6
Cone14ag0059 . 116 324 Chloroplast and Mitochondria Gene Families AT5G52570 56.9 2.3e-55 213.0
Cone15ag0063 . 121 327 Chloroplast and Mitochondria Gene Families AT5G52570 56.5 4.4e-54 208.8
Cone14ag0059 . 1 239 Chloroplast and Mitochondria Gene Families AT4G25700 57.3 6.9e-65 244.6
Cone15ag0063 . 1 244 Chloroplast and Mitochondria Gene Families AT4G25700 55.7 1.9e-62 236.5
Cone3ag1384 . 127 304 Chloroplast and Mitochondria Gene Families AT4G03320 53.6 7.9e-58 221.5
Cone14ag1086 . 22 368 Chloroplast and Mitochondria Gene Families AT5G54290 74.0 9.7e-130 460.7
Cone16ag0356 . 34 544 Chloroplast and Mitochondria Gene Families AT2G18710 82.3 3.7e-237 818.1
Cone2ag0611 . 39 384 Chloroplast and Mitochondria Gene Families AT2G18710 53.3 1.6e-118 424.1
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0000158 13 5 7 13 5 6 0 6 5 5 5 5 10 6 7 9 5 6 7 6 6 18 5 5 6 7 8 8 5 2 201