Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cpe03g00938 ATGAACGATCTTCTTTCGGATTCCTTTGAGATCCCTCGGGGTCAGCCTTCTAGAGGAGGAGACATTGAGCTTGGAACAAATGCTCCTACAAGTGCAGGAGATCTGGGGTTGGATGATTTCTTTAAAAAGGTCCAAGATATTGAAAAACAGAATGAGAAGCTGGACAGGTTATTGCGAAAACTCCAGGATTCACACGAGGAGTCCAAAGCTGTGACTAAAGCTCCAGCAATGAAAGCAATCAAGCAGCGAATGGAAAAGGATGTTGATGAAGTTGGAAAAGTTGCACGTTTTGTGAAGAGCAAGGTCGAAGAACTTGACAAGGAGAATCTGGCAAATAGGCAGAAGCCTGGATGTGGTAAAGGATCAGGTGTAGATAGATCAAGAACAGCAACTACTCTTGCCTTAAAAAAGAAGTTGAAAGACAAGATGACTGAGTTCCAGATTTTGCGGGAAAAAGTTCATCAAGAGTATCGGGAGGTTGTTGAGAGACGGGTTTTCACAGTCACGGGCGCTAGGGCTGACGAAGAGACCATCGAGAAATTAATCGAAACTGGGGATAGCGAACAAATTTTTCAGAAGGCAATTCAAGAACAAGGGCGAGGACAGGTAATGGACACTCTAGCTGAAATTCAAGAGCGTCACAGCGCAGTTAGAGAACTGGAGAGGAAGTTACTCGAGCTACAGCAGGTATTTCTGGACATGGCTGTTTTGGTAGATGCACAGGGGGATATGCTCGACAATATCGAATCACATGTTACAAGTGCAGTAGATCATGTGCAACAAGGGAACACTGCACTTCAAAAGGCAAAGAAGCTTCAAAAGAATTCAAGGAAATGGATGTGCATTGCCATAATAATCCTTCTAATCATTGTTGTGGTGGTAGTAGTGGGAGTCCTAAAGCCATGGAATAGTGGTAAGGGTGCGTAA 927 44.01 MNDLLSDSFEIPRGQPSRGGDIELGTNAPTSAGDLGLDDFFKKVQDIEKQNEKLDRLLRKLQDSHEESKAVTKAPAMKAIKQRMEKDVDEVGKVARFVKSKVEELDKENLANRQKPGCGKGSGVDRSRTATTLALKKKLKDKMTEFQILREKVHQEYREVVERRVFTVTGARADEETIEKLIETGDSEQIFQKAIQEQGRGQVMDTLAEIQERHSAVRELERKLLELQQVFLDMAVLVDAQGDMLDNIESHVTSAVDHVQQGNTALQKAKKLQKNSRKWMCIAIIILLIIVVVVVVGVLKPWNSGKGA 308
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
3 6854115 6870619 + Cp4.1LG03g09390.1 Cpe03g00938 466655

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cpe03g00938 308 MobiDBLite consensus disorder prediction 1 35 - -
Cpe03g00938 308 Coils Coil 210 230 - -
Cpe03g00938 308 ProSitePatterns Syntaxin / epimorphin family signature. 213 252 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cpe03g00938 308 CDD SNARE_syntaxin1-like 206 268 - -
Cpe03g00938 308 Pfam Syntaxin 39 242 IPR006011 GO:0016020
Cpe03g00938 308 CDD SynN 37 194 IPR006011 GO:0016020
Cpe03g00938 308 SMART tSNARE_6 202 269 IPR000727 -
Cpe03g00938 308 SMART SynN_4 32 158 IPR006011 GO:0016020
Cpe03g00938 308 Gene3D - 197 300 - -
Cpe03g00938 308 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 207 269 IPR000727 -
Cpe03g00938 308 PANTHER SYNTAXIN 3 299 IPR045242 -
Cpe03g00938 308 PANTHER - 3 299 - -
Cpe03g00938 308 Pfam SNARE domain 243 295 IPR000727 -
Cpe03g00938 308 Gene3D - 34 161 - -
Cpe03g00938 308 Coils Coil 37 71 - -
Cpe03g00938 308 SUPERFAMILY t-snare proteins 35 262 IPR010989 GO:0016020|GO:0016192
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cpe03g00938 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101203075 512.686
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cpe03g00938 Cpe-Chr3:6854115 Cpe19g00503 Cpe-Chr19:4303812 6.46E-93 dispersed
Cpe03g00938 Cpe-Chr3:6854115 Cpe20g00409 Cpe-Chr20:2339171 1.59E-94 transposed
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cpe11g00567 . 8 340 SNARE and Associated Proteins AT3G24350 65.4 2.4e-103 372.9
Cpe07g00260 . 31 377 SNARE and Associated Proteins AT3G24350 60.2 2.1e-91 333.2
Cpe19g00189 . 1 308 SNARE and Associated Proteins AT1G08560 68.5 6.5e-102 367.9
Cpe10g01038 CST 1 312 SNARE and Associated Proteins AT1G08560 68.0 6.3e-97 351.3
Cpe10g00620 . 10 311 SNARE and Associated Proteins AT2G18260 53.6 1.8e-83 306.6
Cpe03g00316 . 19 279 SNARE and Associated Proteins AT3G11820 81.6 2.1e-116 416.0
Cpe08g00962 CST 19 279 SNARE and Associated Proteins AT3G11820 77.4 1.0e-110 397.1
Cpe19g00503 . 21 278 SNARE and Associated Proteins AT3G11820 70.2 4.0e-99 358.6
Cpe20g00409 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 1.8e-91 333.2
Cpe03g00938 . 27 285 SNARE and Associated Proteins AT3G11820 52.1 5.6e-69 258.5
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT3G52400 64.3 6.1e-93 338.2
Cpe08g00962 CST 1 279 SNARE and Associated Proteins AT3G52400 61.5 5.9e-88 321.6
Cpe19g00503 . 1 277 SNARE and Associated Proteins AT3G52400 59.4 1.4e-84 310.5
Cpe20g00409 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.4e-81 299.7
Cpe20g00409 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.1e-106 383.6
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.9e-82 303.1
Cpe08g00962 CST 1 284 SNARE and Associated Proteins AT4G03330 56.6 9.6e-82 300.8
Cpe19g00503 . 1 278 SNARE and Associated Proteins AT4G03330 52.8 3.9e-75 278.9
Cpe03g00938 . 1 285 SNARE and Associated Proteins AT4G03330 52.3 1.4e-69 260.4
Cpe20g00409 . 1 303 SNARE and Associated Proteins AT1G61290 76.9 1.8e-125 446.0
Cpe08g00962 CST 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.3e-91 332.8
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT1G61290 61.9 4.3e-90 328.6
Cpe19g00503 . 1 296 SNARE and Associated Proteins AT1G61290 54.9 2.8e-81 299.3
Cpe09g00868 . 1 220 SNARE and Associated Proteins AT1G61290 56.1 7.6e-79 291.2
Cpe20g00409 . 1 303 SNARE and Associated Proteins AT1G11250 76.2 1.1e-122 436.8
Cpe08g00962 CST 1 294 SNARE and Associated Proteins AT1G11250 60.2 6.3e-94 341.3
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 2.4e-93 339.3
Cpe19g00503 . 1 291 SNARE and Associated Proteins AT1G11250 54.6 1.9e-82 303.1
Cpe09g00868 . 1 220 SNARE and Associated Proteins AT1G11250 56.4 9.1e-77 284.3
Cpe03g00938 . 1 285 SNARE and Associated Proteins AT1G11250 50.5 3.7e-70 262.3
Cpe03g00938 . 1 308 SNARE and Associated Proteins AT3G03800 74.0 1.9e-117 419.5
Cpe03g00938 . 1 203 SNARE and Associated Proteins AT5G08080 77.3 7.8e-81 297.4
Cpe16g00449 CST 2 149 SNARE and Associated Proteins AT5G08080 56.5 2.7e-41 166.0
Cpe08g00870 . 1 256 SNARE and Associated Proteins AT5G16830 59.9 9.4e-76 280.8
Cpe14g00975 . 1 256 SNARE and Associated Proteins AT5G16830 59.9 9.4e-76 280.8
Cpe08g00870 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.5e-81 299.3
Cpe14g00975 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.2e-80 297.0
Cpe08g00870 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.8e-74 275.8
Cpe14g00975 . 1 256 SNARE and Associated Proteins AT4G17730 61.7 6.3e-74 274.6
Cpe14g00975 . 65 256 SNARE and Associated Proteins AT1G32270 60.9 4.7e-53 205.7
Cpe08g00870 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.2e-51 201.1
Cpe01g01046 CCT 1 334 SNARE and Associated Proteins AT5G05760 66.0 5.8e-112 401.4
Cpe01g00138 CCT 1 321 SNARE and Associated Proteins AT5G05760 60.1 3.6e-98 355.5
Cpe11g00567 . 8 340 SNARE and Associated Proteins AT3G24350 65.4 2.4e-103 372.9
Cpe07g00260 . 31 377 SNARE and Associated Proteins AT3G24350 60.2 2.1e-91 333.2
Cpe07g00878 CST 1 327 SNARE and Associated Proteins AT5G26980 75.5 3.9e-126 448.4
Cpe11g00890 CST 1 328 SNARE and Associated Proteins AT5G26980 75.9 1.5e-125 446.4
Cpe12g00911 . 1 287 SNARE and Associated Proteins AT5G26980 64.4 3.3e-88 322.4
Cpe11g00890 CST 1 330 SNARE and Associated Proteins AT4G02195 64.0 2.0e-106 382.9
Cpe07g00878 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.0e-102 369.0
Cpe12g00911 . 1 287 SNARE and Associated Proteins AT4G02195 65.5 1.1e-91 334.0
Cpe11g00890 CST 1 329 SNARE and Associated Proteins AT3G05710 75.1 5.6e-128 454.5
Cpe07g00878 CST 1 328 SNARE and Associated Proteins AT3G05710 74.2 6.2e-127 451.1
Cpe12g00911 . 1 287 SNARE and Associated Proteins AT3G05710 62.0 4.1e-86 315.5
Cpe02g00792 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.8 1.0e-91 333.6
Cpe06g00787 CCT,CST 1 221 SNARE and Associated Proteins AT1G16240 67.0 3.8e-78 288.5
Cpe14g00748 CCT 3 144 SNARE and Associated Proteins AT1G16240 53.5 2.2e-41 166.4
Cpe02g00792 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.4 5.7e-91 331.3
Cpe06g00787 CCT,CST 1 221 SNARE and Associated Proteins AT1G79590 67.8 2.5e-78 289.3
Cpe14g00748 CCT 2 144 SNARE and Associated Proteins AT1G79590 52.4 1.7e-42 170.2
Cpe12g00037 . 110 296 SNARE and Associated Proteins AT1G28490 69.0 1.1e-62 236.9
Cpe03g00174 . 1 264 SNARE and Associated Proteins AT3G09740 77.4 6.6e-111 397.5
Cpe02g00841 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 2.8e-109 392.1
Cpe05g00828 . 1 263 SNARE and Associated Proteins AT3G09740 67.2 3.4e-91 332.0
Cpe03g00174 . 1 264 SNARE and Associated Proteins AT3G45280 62.9 1.1e-86 317.0
Cpe02g00841 . 1 261 SNARE and Associated Proteins AT3G45280 64.0 1.5e-86 316.6
Cpe05g00828 . 1 263 SNARE and Associated Proteins AT3G45280 62.7 1.7e-82 303.1
Cpe02g00841 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 2.2e-95 345.9
Cpe03g00174 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 2.9e-95 345.5
Cpe05g00828 . 1 260 SNARE and Associated Proteins AT3G61450 59.7 4.5e-80 295.0
Cpe01g02531 CCT 122 366 SNARE and Associated Proteins AT1G51740 74.4 6.8e-94 340.9
Cpe13g01079 CCT 171 415 SNARE and Associated Proteins AT1G51740 73.2 4.4e-93 338.2
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001189 1 6 1 1 1 2 3 2 2 2 2 2 3 2 3 3 2 4 3 2 3 1 2 3 3 2 3 8 3 2 77
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cpe03g00938 Cpe_Chr03 FPKM 23.892139 28.772058 44.6875 43.190487 7.223724 6.578745 7.446153 25.613674 25.575186 25.720261