Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cpe04g00023 ATGGAAGATTCCCCGCAATCAGCCGGTGATCGGAAGACCCGTTTCTACCACCCCTACCAAGACCTTCACGTCCCGATCACCAAGCTTTACGAGCTTCCCACCGCCCCAGAACATCTTTTCTTCGAAGAGGCGGCTAGGCCCCACCGTTCTTGGGGCGAAAATCTCCAGTACTACACCGGAATCGGCTACTTGTCCGGTGCCCTTTTTGGCGGCGCCAGGGGATCTCTCCAGGGCATTAGGGCGGCGGAGCCTGGCGACACCATGAAGCTTCGTCTTAATCGAGTTTTGAACTCTGGGGGTCAGGTCGGCCGCAGGGCTGGGAACTCTCTTGGGATTCTTGGCTTGATTTTTGCTGGTTTGGAAAGTGGGGTTACTCATTTGAGAGGCTCTGATGATGTTTTGAATAGTATTGTTGCTGGATTGGGGACTGGTGCAATTTATAAGGCGGCTTCAGGGCCGAGGTCGGCCGCCATCGCTGGTGCTATTGGAGGGATTGCTGCTGCAGCTGCGGTGGCGGGCAAGCAGGCAGCGAAGAGATATGTGCCAATATAG 552 55.62 MEDSPQSAGDRKTRFYHPYQDLHVPITKLYELPTAPEHLFFEEAARPHRSWGENLQYYTGIGYLSGALFGGARGSLQGIRAAEPGDTMKLRLNRVLNSGGQVGRRAGNSLGILGLIFAGLESGVTHLRGSDDVLNSIVAGLGTGAIYKAASGPRSAAIAGAIGGIAAAAAVAGKQAAKRYVPI 183
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
4 212033 212584 - Cp4.1LG04g01900.1 Cpe04g00023 467585

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cpe04g00023 183 PANTHER MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM23-3 1 183 - -
Cpe04g00023 183 Pfam Tim17/Tim22/Tim23/Pmp24 family 57 165 - -
Cpe04g00023 183 PANTHER TIM23 1 183 IPR045238 GO:0022857
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cpe04g00023 K17794 TIM23; mitochondrial import inner membrane translocase subunit TIM23 - csv:116401801 312.768
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cpe04g00023 Cpe-Chr4:212033 Cpe12g00606 Cpe-Chr12:6042466 1.11E-70 dispersed
Cpe04g00023 Cpe-Chr4:212033 Cpe05g00848 Cpe-Chr5:5525959 8.46E-107 wgd
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cpe02g01243 . 70 517 Chloroplast and Mitochondria Gene Families AT2G28800 61.1 4.8e-135 478.4
Cpe11g00044 . 71 421 Chloroplast and Mitochondria Gene Families AT2G28800 56.5 5.9e-101 365.2
Cpe07g00037 . 71 423 Chloroplast and Mitochondria Gene Families AT2G28800 53.8 7.4e-96 348.2
Cpe13g00676 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 83.1 8.9e-121 430.3
Cpe04g00386 . 6 258 Chloroplast and Mitochondria Gene Families AT1G15820 81.6 1.3e-119 426.4
Cpe04g00672 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 89.5 1.7e-144 509.2
Cpe02g01544 CCT 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.2 6.6e-120 427.6
Cpe10g00102 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 2.5e-119 425.6
Cpe16g00726 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 76.6 4.3e-119 424.9
Cpe19g01123 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 4.3e-119 424.9
Cpe03g00823 CCT 1 245 Chloroplast and Mitochondria Gene Families AT3G27690 69.4 3.7e-102 368.6
Cpe14g00702 . 7 266 Chloroplast and Mitochondria Gene Families AT3G27690 66.4 3.6e-97 352.1
Cpe01g00833 . 5 264 Chloroplast and Mitochondria Gene Families AT3G27690 66.4 7.9e-97 350.9
Cpe02g00975 . 73 276 Chloroplast and Mitochondria Gene Families AT3G27690 52.2 2.0e-52 203.4
Cpe20g00513 . 1 107 Chloroplast and Mitochondria Gene Families AT3G27690 56.9 7.8e-44 174.9
Cpe09g00591 CST 45 271 Chloroplast and Mitochondria Gene Families AT3G61470 81.6 3.5e-117 418.3
Cpe01g01617 CST 27 227 Chloroplast and Mitochondria Gene Families AT3G61470 74.4 2.1e-98 355.9
Cpe04g01009 . 60 265 Chloroplast and Mitochondria Gene Families AT3G61470 65.5 2.7e-85 312.4
Cpe18g00788 CCT,ECH 22 250 Chloroplast and Mitochondria Gene Families AT3G61470 50.2 2.2e-63 239.6
Cpe04g01495 CCT,ECH 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 50.8 2.5e-62 236.1
Cpe02g01055 . 22 245 Chloroplast and Mitochondria Gene Families AT3G61470 50.6 4.2e-62 235.3
Cpe13g00808 CCT 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.6 4.3e-89 324.7
Cpe01g02245 CCT 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 80.4 3.7e-88 321.6
Cpe10g00945 . 54 338 Chloroplast and Mitochondria Gene Families AT3G08940 83.6 4.9e-136 481.1
Cpe19g00292 . 58 323 Chloroplast and Mitochondria Gene Families AT3G08940 75.4 1.3e-117 419.9
Cpe04g00672 . 47 256 Chloroplast and Mitochondria Gene Families AT1G76570 50.5 4.5e-53 205.7
Cpe18g00215 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 85.3 1.8e-135 479.2
Cpe04g00872 . 1 269 Chloroplast and Mitochondria Gene Families AT1G61520 85.0 6.9e-132 467.2
Cpe04g00672 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 3.4e-144 508.1
Cpe10g00102 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 7.7e-120 427.2
Cpe16g00726 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 2.9e-119 425.2
Cpe19g01123 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 77.8 5.0e-119 424.5
Cpe02g01544 CCT 8 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.8 3.2e-118 421.8
Cpe03g00823 CCT 1 245 Chloroplast and Mitochondria Gene Families AT2G05070 70.0 1.2e-101 366.7
Cpe14g00702 . 10 266 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 5.4e-97 351.3
Cpe01g00833 . 8 264 Chloroplast and Mitochondria Gene Families AT2G05070 67.7 9.2e-97 350.5
Cpe02g00975 . 73 276 Chloroplast and Mitochondria Gene Families AT2G05070 52.6 1.4e-52 203.8
Cpe20g00513 . 1 107 Chloroplast and Mitochondria Gene Families AT2G05070 56.9 1.5e-43 173.7
Cpe04g00672 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.5e-125 446.4
Cpe10g00102 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 2.5e-101 365.9
Cpe02g01544 CCT 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 77.6 2.8e-100 362.5
Cpe19g01123 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 2.8e-100 362.5
Cpe16g00726 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.1 8.1e-100 360.9
Cpe03g00823 CCT 1 210 Chloroplast and Mitochondria Gene Families AT2G05100 74.2 3.3e-85 312.4
Cpe14g00702 . 10 238 Chloroplast and Mitochondria Gene Families AT2G05100 67.2 4.5e-82 302.0
Cpe01g00833 . 8 236 Chloroplast and Mitochondria Gene Families AT2G05100 67.2 1.0e-81 300.8
Cpe02g00975 . 73 260 Chloroplast and Mitochondria Gene Families AT2G05100 50.8 1.4e-43 174.1
Cpe10g00945 . 53 221 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 6.3e-68 254.2
Cpe19g00292 . 61 215 Chloroplast and Mitochondria Gene Families AT2G40100 71.1 8.2e-60 227.3
Cpe16g00726 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 87.7 2.9e-135 478.4
Cpe10g00102 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.6 1.9e-134 475.7
Cpe19g01123 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 9.5e-134 473.4
Cpe02g01544 CCT 4 265 Chloroplast and Mitochondria Gene Families AT1G29930 85.3 1.5e-126 449.5
Cpe04g00672 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 2.0e-115 412.5
Cpe03g00823 CCT 3 245 Chloroplast and Mitochondria Gene Families AT1G29930 75.9 9.5e-110 393.7
Cpe01g00833 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29930 74.5 1.6e-93 339.7
Cpe14g00702 . 48 266 Chloroplast and Mitochondria Gene Families AT1G29930 74.5 1.6e-93 339.7
Cpe02g00975 . 73 276 Chloroplast and Mitochondria Gene Families AT1G29930 51.4 1.1e-52 204.1
Cpe20g00513 . 1 107 Chloroplast and Mitochondria Gene Families AT1G29930 59.0 4.4e-46 182.2
Cpe16g00726 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 1.1e-134 476.5
Cpe10g00102 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 87.3 7.3e-134 473.8
Cpe19g01123 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 3.6e-133 471.5
Cpe02g01544 CCT 4 265 Chloroplast and Mitochondria Gene Families AT1G29920 85.3 1.9e-126 449.1
Cpe04g00672 . 31 265 Chloroplast and Mitochondria Gene Families AT1G29920 83.7 2.6e-115 412.1
Cpe03g00823 CCT 3 245 Chloroplast and Mitochondria Gene Families AT1G29920 75.9 1.2e-109 393.3
Cpe01g00833 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29920 74.5 1.6e-93 339.7
Cpe14g00702 . 48 266 Chloroplast and Mitochondria Gene Families AT1G29920 74.5 1.6e-93 339.7
Cpe02g00975 . 73 276 Chloroplast and Mitochondria Gene Families AT1G29920 51.4 1.1e-52 204.1
Cpe20g00513 . 1 107 Chloroplast and Mitochondria Gene Families AT1G29920 59.0 4.4e-46 182.2
Cpe16g00726 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 1.1e-134 476.5
Cpe10g00102 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 87.3 7.3e-134 473.8
Cpe19g01123 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 3.6e-133 471.5
Cpe02g01544 CCT 4 265 Chloroplast and Mitochondria Gene Families AT1G29910 85.3 1.9e-126 449.1
Cpe04g00672 . 31 265 Chloroplast and Mitochondria Gene Families AT1G29910 83.7 2.6e-115 412.1
Cpe03g00823 CCT 3 245 Chloroplast and Mitochondria Gene Families AT1G29910 75.9 1.2e-109 393.3
Cpe01g00833 . 46 264 Chloroplast and Mitochondria Gene Families AT1G29910 74.5 1.6e-93 339.7
Cpe14g00702 . 48 266 Chloroplast and Mitochondria Gene Families AT1G29910 74.5 1.6e-93 339.7
Cpe02g00975 . 73 276 Chloroplast and Mitochondria Gene Families AT1G29910 51.4 1.1e-52 204.1
Cpe20g00513 . 1 107 Chloroplast and Mitochondria Gene Families AT1G29910 59.0 4.4e-46 182.2
Cpe02g00975 . 11 291 Chloroplast and Mitochondria Gene Families AT4G10340 82.6 1.1e-132 469.9
Cpe10g00102 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 7.5e-57 218.0
Cpe19g01123 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.0 9.8e-57 217.6
Cpe16g00726 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.3e-56 217.2
Cpe02g01544 CCT 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 53.6 2.9e-56 216.1
Cpe04g00672 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.2 3.5e-54 209.1
Cpe01g00833 . 46 252 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 4.3e-52 202.2
Cpe14g00702 . 48 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 4.3e-52 202.2
Cpe16g00726 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 87.7 1.9e-134 475.7
Cpe10g00102 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 1.2e-133 473.0
Cpe19g01123 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 6.1e-133 470.7
Cpe02g01544 CCT 4 265 Chloroplast and Mitochondria Gene Families AT2G34420 86.0 2.2e-127 452.2
Cpe04g00672 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 76.8 8.8e-116 413.7
Cpe03g00823 CCT 3 245 Chloroplast and Mitochondria Gene Families AT2G34420 76.3 1.9e-110 396.0
Cpe01g00833 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34420 75.0 2.1e-93 339.3
Cpe14g00702 . 48 266 Chloroplast and Mitochondria Gene Families AT2G34420 75.0 2.1e-93 339.3
Cpe02g00975 . 73 276 Chloroplast and Mitochondria Gene Families AT2G34420 50.5 5.3e-52 201.8
Cpe20g00513 . 1 107 Chloroplast and Mitochondria Gene Families AT2G34420 59.6 4.3e-46 182.2
Cpe10g00102 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.0e-135 479.9
Cpe16g00726 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 87.3 1.1e-134 476.5
Cpe19g01123 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 87.6 1.1e-134 476.5
Cpe02g01544 CCT 4 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.0 3.1e-129 458.4
Cpe04g00672 . 30 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.3 1.3e-114 409.8
Cpe03g00823 CCT 3 245 Chloroplast and Mitochondria Gene Families AT2G34430 77.0 9.2e-113 403.7
Cpe01g00833 . 46 264 Chloroplast and Mitochondria Gene Families AT2G34430 75.0 2.8e-93 339.0
Cpe14g00702 . 48 266 Chloroplast and Mitochondria Gene Families AT2G34430 75.0 2.8e-93 339.0
Cpe20g00513 . 1 107 Chloroplast and Mitochondria Gene Families AT2G34430 59.6 4.3e-46 182.2
Cpe10g00945 . 56 338 Chloroplast and Mitochondria Gene Families AT5G01530 83.1 1.3e-136 483.0
Cpe19g00292 . 58 323 Chloroplast and Mitochondria Gene Families AT5G01530 74.8 7.2e-119 424.1
Cpe01g00782 . 48 307 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 7.5e-144 506.9
Cpe14g00637 . 52 339 Chloroplast and Mitochondria Gene Families AT5G40810 85.1 6.6e-140 493.8
Cpe01g00782 . 1 307 Chloroplast and Mitochondria Gene Families AT3G27240 84.8 1.2e-148 523.1
Cpe14g00637 . 26 339 Chloroplast and Mitochondria Gene Families AT3G27240 80.1 6.0e-140 494.2
Cpe16g00674 CCT,ECH 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 74.4 4.4e-141 498.0
Cpe05g00987 CCT,ECH 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 74.1 7.6e-141 497.3
Cpe10g00970 . 3 303 Chloroplast and Mitochondria Gene Families AT2G30160 65.7 4.3e-112 401.7
Cpe19g00268 . 9 310 Chloroplast and Mitochondria Gene Families AT2G30160 65.2 1.8e-110 396.4
Cpe05g00987 CCT,ECH 5 329 Chloroplast and Mitochondria Gene Families AT1G07030 74.4 2.8e-140 495.4
Cpe16g00674 CCT,ECH 1 327 Chloroplast and Mitochondria Gene Families AT1G07030 74.4 1.1e-139 493.4
Cpe10g00970 . 3 303 Chloroplast and Mitochondria Gene Families AT1G07030 68.6 3.4e-117 418.7
Cpe19g00268 . 5 310 Chloroplast and Mitochondria Gene Families AT1G07030 65.6 1.9e-112 402.9
Cpe12g00913 CCT 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 3.1e-136 481.9
Cpe17g00770 CCT 593 862 Chloroplast and Mitochondria Gene Families AT2G47490 72.9 6.5e-118 421.0
Cpe13g00396 . 11 290 Chloroplast and Mitochondria Gene Families AT2G47490 59.7 2.8e-97 352.4
Cpe13g00396 . 3 341 Chloroplast and Mitochondria Gene Families AT1G25380 57.8 1.8e-106 383.3
Cpe12g00913 CCT 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 63.8 3.9e-106 382.1
Cpe17g00770 CCT 596 853 Chloroplast and Mitochondria Gene Families AT1G25380 62.1 2.4e-95 346.3
Cpe20g00406 . 1 584 Chloroplast and Mitochondria Gene Families AT4G21490 74.2 2.0e-258 888.6
Cpe15g00785 CCT 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.4 1.4e-222 769.6
Cpe05g01477 CCT 5 534 Chloroplast and Mitochondria Gene Families AT4G21490 63.1 5.5e-203 704.5
Cpe17g00473 . 4 186 Chloroplast and Mitochondria Gene Families AT1G17530 65.6 2.3e-62 235.7
Cpe12g00606 . 15 186 Chloroplast and Mitochondria Gene Families AT1G17530 67.6 1.5e-61 233.0
Cpe04g00023 . 10 179 Chloroplast and Mitochondria Gene Families AT1G17530 59.9 1.2e-50 196.8
Cpe05g00848 . 5 180 Chloroplast and Mitochondria Gene Families AT1G17530 57.3 1.5e-50 196.4
Cpe05g00848 . 15 184 Chloroplast and Mitochondria Gene Families AT3G04800 59.1 9.2e-51 197.2
Cpe04g00023 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 57.2 1.6e-50 196.4
Cpe17g00473 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 1.4e-43 173.3
Cpe12g00606 . 22 190 Chloroplast and Mitochondria Gene Families AT3G04800 55.0 5.4e-43 171.4
Cpe17g00473 . 15 190 Chloroplast and Mitochondria Gene Families AT1G72750 69.1 9.5e-64 240.4
Cpe12g00606 . 5 190 Chloroplast and Mitochondria Gene Families AT1G72750 65.8 1.6e-63 239.6
Cpe05g00848 . 5 184 Chloroplast and Mitochondria Gene Families AT1G72750 59.0 9.9e-53 203.8
Cpe04g00023 . 10 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.8 4.9e-52 201.4
Cpe09g00268 . 1 240 Chloroplast and Mitochondria Gene Families AT1G26100 58.3 3.5e-71 265.4
Cpe01g02464 CCT,ECH 34 281 Chloroplast and Mitochondria Gene Families AT5G38630 64.3 4.9e-86 314.7
Cpe15g00317 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 75.0 2.9e-85 312.4
Cpe05g00656 . 23 218 Chloroplast and Mitochondria Gene Families AT4G25570 67.3 1.5e-76 283.5
Cpe01g01926 CCT,ECH 9 364 Chloroplast and Mitochondria Gene Families AT5G14040 81.3 1.2e-169 593.2
Cpe13g00493 CCT,ECH 9 364 Chloroplast and Mitochondria Gene Families AT5G14040 80.8 3.7e-168 588.2
Cpe18g00933 . 39 347 Chloroplast and Mitochondria Gene Families AT5G14040 84.6 4.7e-155 544.7
Cpe04g00457 . 9 354 Chloroplast and Mitochondria Gene Families AT5G14040 73.2 1.8e-151 532.7
Cpe13g00493 CCT,ECH 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 71.2 9.5e-145 510.4
Cpe01g01926 CCT,ECH 8 362 Chloroplast and Mitochondria Gene Families AT3G48850 69.7 4.7e-144 508.1
Cpe18g00933 . 12 347 Chloroplast and Mitochondria Gene Families AT3G48850 69.6 1.3e-141 500.0
Cpe04g00457 . 11 351 Chloroplast and Mitochondria Gene Families AT3G48850 69.9 3.3e-137 485.3
Cpe04g00636 . 10 271 Chloroplast and Mitochondria Gene Families AT2G17270 68.0 5.7e-106 381.3
Cpe13g00493 CCT,ECH 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.2 2.5e-85 312.8
Cpe01g01926 CCT,ECH 62 353 Chloroplast and Mitochondria Gene Families AT2G17270 51.4 3.6e-84 308.9
Cpe18g00933 . 51 348 Chloroplast and Mitochondria Gene Families AT2G17270 50.2 3.6e-84 308.9
Cpe13g00986 CCT 16 306 Chloroplast and Mitochondria Gene Families AT5G15640 73.0 1.1e-120 430.3
Cpe01g02433 CCT 16 261 Chloroplast and Mitochondria Gene Families AT5G15640 76.9 1.6e-103 373.2
Cpe02g00281 CCT 1 341 Chloroplast and Mitochondria Gene Families AT5G26200 66.6 2.1e-125 446.0
Cpe06g00253 CCT 12 344 Chloroplast and Mitochondria Gene Families AT5G26200 67.3 6.0e-125 444.5
Cpe17g00470 . 1 333 Chloroplast and Mitochondria Gene Families AT5G26200 57.5 3.6e-101 365.5
Cpe12g00598 . 1 319 Chloroplast and Mitochondria Gene Families AT5G26200 60.6 2.0e-99 359.8
Cpe17g00470 . 1 340 Chloroplast and Mitochondria Gene Families AT1G72820 73.9 5.9e-144 507.7
Cpe12g00598 . 1 323 Chloroplast and Mitochondria Gene Families AT1G72820 76.7 5.4e-137 484.6
Cpe02g00281 CCT 1 342 Chloroplast and Mitochondria Gene Families AT1G72820 69.9 2.2e-130 462.6
Cpe06g00253 CCT 1 345 Chloroplast and Mitochondria Gene Families AT1G72820 69.6 3.2e-129 458.8
Cpe09g00069 CCT,ECH 97 300 Chloroplast and Mitochondria Gene Families AT5G52570 58.3 1.1e-56 217.2
Cpe13g00137 . 130 318 Chloroplast and Mitochondria Gene Families AT5G52570 51.9 1.5e-45 180.3
Cpe14g00086 CCT,ECH 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 62.8 1.2e-68 256.9
Cpe09g00069 CCT,ECH 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 62.3 2.2e-67 252.7
Cpe13g00137 . 62 235 Chloroplast and Mitochondria Gene Families AT4G25700 56.3 3.2e-50 195.7
Cpe14g00700 . 88 321 Chloroplast and Mitochondria Gene Families AT5G54290 75.2 1.7e-101 366.7
Cpe04g01282 . 43 570 Chloroplast and Mitochondria Gene Families AT2G18710 80.6 8.5e-238 820.1
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0011351 1 1 1 0 1 1 2 1 1 1 1 1 2 1 1 2 1 0 2 1 1 1 1 1 1 1 0 1 1 1 31
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cpe04g00023 Cpe_Chr04 FPKM 20.768421 22.507349 15.148429 14.362634 4.53667 4.768338 4.721803 2.432562 2.429547 3.12531