Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cpe05g00828 ATGACCGTAATCGACGTCATCTTCCGAGTCGATTCCATTTGCAAGAAATACGAGAAGTATGATGTCGAGAAACAGCGCGAGCTCAATGCTTATGGTGATGATGTTTTTGCTCGCCTCTACGCCGCCGTCGAACTCGAAATCGAAGCCGCTCTCCAGAAATATGAGAGTGCCTGTACGGAGAAGAATAGGGCTGCTGCAGTTGCGATGAACGCTGAGGTTCGGCGGAAGAAGGCCCGATTGATGGATGAAGTTCCCAAGCTTCATAAATTGGCTCGCAAGAAGATTAAAGGGGTTCCGAAAGAAGAGCTTGAGGTCAGAGGTGATCTTGTTCTTGCGCTTGAAGAGAGGATTAAAGCGATTCCAGATGGGAGTACGACAGGCAAACCATCTGGAGGATGGGCCTCCACCTCATCTAACAATATTAAGTTTGATTCAACAACAGATGGACACTTCGAGAGCGAGTATTTCCAACAAAGCGAAGAATCGAGTCAATTTCGACAGGAGTATGATATGCGGAAGATGAAACAGGCATGTCTGGATGTCATATCTGAAGGGTTGGATATGCTGAAAAATCTAGCCCATGATATGAATGAGGAATTGGATAGGCAAGTTCCATTAATTGACGAGATTGACTCAAAGGTAGACAAGGTGACTAATGAGATGAAAAACACCAATGTTAGGCTCAAGCAAACACTGAATGAGGTGAGATCCAGCCAAAACTTCTGCATCGATATCATTCTTCTCTGTATAATTCTTGGAATCGCTTCTTACTTGTACAATATATTGAGCGGAAATGGTTGA 801 44.32 MTVIDVIFRVDSICKKYEKYDVEKQRELNAYGDDVFARLYAAVELEIEAALQKYESACTEKNRAAAVAMNAEVRRKKARLMDEVPKLHKLARKKIKGVPKEELEVRGDLVLALEERIKAIPDGSTTGKPSGGWASTSSNNIKFDSTTDGHFESEYFQQSEESSQFRQEYDMRKMKQACLDVISEGLDMLKNLAHDMNEELDRQVPLIDEIDSKVDKVTNEMKNTNVRLKQTLNEVRSSQNFCIDIILLCIILGIASYLYNILSGNG 266
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
5 5125039 5126961 - Cp4.1LG05g08260.1 Cpe05g00828 470033

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cpe05g00828 266 CDD SNARE_Qc 179 230 - -
Cpe05g00828 266 Pfam SNARE domain 206 255 IPR000727 -
Cpe05g00828 266 SUPERFAMILY SNARE fusion complex 177 229 - -
Cpe05g00828 266 Gene3D - 171 230 - -
Cpe05g00828 266 Coils Coil 207 234 - -
Cpe05g00828 266 PANTHER SYNTAXIN 1 260 IPR045242 -
Cpe05g00828 266 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 169 231 IPR000727 -
Cpe05g00828 266 PANTHER SYNTAXIN-73 1 260 - -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cpe05g00828 K08506 SYP7; syntaxin of plants SYP7 - csv:101211289 416.387
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cpe02g00841 Cpe-Chr2:5402543 Cpe05g00828 Cpe-Chr5:5125039 9.23E-119 dispersed
Cpe16g00543 Cpe-Chr16:6290195 Cpe05g00828 Cpe-Chr5:5125039 1.54E-77 wgd
Cpe03g00174 Cpe-Chr3:858407 Cpe05g00828 Cpe-Chr5:5125039 1.69E-119 wgd
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi6g289 . . Bda02g00767 . Bpe01g00179 . . . . . . . . . . Cpe05g00828 . . . . . . . . Cla02g02052 Cam02g2177 Cec02g2216 Cco02g2256 Clacu02g2162 Cmu02g2099 Cre02g2412 . Cone5ag1222 . . . . . Cme11g01789 . Blo14g00167 . . . . . Bma11g00164 Sed05g2859 Cmo02g00885 Cmo20g00513 Cma02g00885 . . Car20g00420 . . Bhi10g00561 Tan05g0265 Cmetu11g0284 . Hepe08g0878 . . . . . . . . . . . . .
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cpe11g00567 . 8 340 SNARE and Associated Proteins AT3G24350 65.4 2.4e-103 372.9
Cpe07g00260 . 31 377 SNARE and Associated Proteins AT3G24350 60.2 2.1e-91 333.2
Cpe19g00189 . 1 308 SNARE and Associated Proteins AT1G08560 68.5 6.5e-102 367.9
Cpe10g01038 CST 1 312 SNARE and Associated Proteins AT1G08560 68.0 6.3e-97 351.3
Cpe10g00620 . 10 311 SNARE and Associated Proteins AT2G18260 53.6 1.8e-83 306.6
Cpe03g00316 . 19 279 SNARE and Associated Proteins AT3G11820 81.6 2.1e-116 416.0
Cpe08g00962 CST 19 279 SNARE and Associated Proteins AT3G11820 77.4 1.0e-110 397.1
Cpe19g00503 . 21 278 SNARE and Associated Proteins AT3G11820 70.2 4.0e-99 358.6
Cpe20g00409 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 1.8e-91 333.2
Cpe03g00938 . 27 285 SNARE and Associated Proteins AT3G11820 52.1 5.6e-69 258.5
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT3G52400 64.3 6.1e-93 338.2
Cpe08g00962 CST 1 279 SNARE and Associated Proteins AT3G52400 61.5 5.9e-88 321.6
Cpe19g00503 . 1 277 SNARE and Associated Proteins AT3G52400 59.4 1.4e-84 310.5
Cpe20g00409 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.4e-81 299.7
Cpe20g00409 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.1e-106 383.6
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.9e-82 303.1
Cpe08g00962 CST 1 284 SNARE and Associated Proteins AT4G03330 56.6 9.6e-82 300.8
Cpe19g00503 . 1 278 SNARE and Associated Proteins AT4G03330 52.8 3.9e-75 278.9
Cpe03g00938 . 1 285 SNARE and Associated Proteins AT4G03330 52.3 1.4e-69 260.4
Cpe20g00409 . 1 303 SNARE and Associated Proteins AT1G61290 76.9 1.8e-125 446.0
Cpe08g00962 CST 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.3e-91 332.8
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT1G61290 61.9 4.3e-90 328.6
Cpe19g00503 . 1 296 SNARE and Associated Proteins AT1G61290 54.9 2.8e-81 299.3
Cpe09g00868 . 1 220 SNARE and Associated Proteins AT1G61290 56.1 7.6e-79 291.2
Cpe20g00409 . 1 303 SNARE and Associated Proteins AT1G11250 76.2 1.1e-122 436.8
Cpe08g00962 CST 1 294 SNARE and Associated Proteins AT1G11250 60.2 6.3e-94 341.3
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 2.4e-93 339.3
Cpe19g00503 . 1 291 SNARE and Associated Proteins AT1G11250 54.6 1.9e-82 303.1
Cpe09g00868 . 1 220 SNARE and Associated Proteins AT1G11250 56.4 9.1e-77 284.3
Cpe03g00938 . 1 285 SNARE and Associated Proteins AT1G11250 50.5 3.7e-70 262.3
Cpe03g00938 . 1 308 SNARE and Associated Proteins AT3G03800 74.0 1.9e-117 419.5
Cpe03g00938 . 1 203 SNARE and Associated Proteins AT5G08080 77.3 7.8e-81 297.4
Cpe16g00449 CST 2 149 SNARE and Associated Proteins AT5G08080 56.5 2.7e-41 166.0
Cpe08g00870 . 1 256 SNARE and Associated Proteins AT5G16830 59.9 9.4e-76 280.8
Cpe14g00975 . 1 256 SNARE and Associated Proteins AT5G16830 59.9 9.4e-76 280.8
Cpe08g00870 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.5e-81 299.3
Cpe14g00975 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.2e-80 297.0
Cpe08g00870 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.8e-74 275.8
Cpe14g00975 . 1 256 SNARE and Associated Proteins AT4G17730 61.7 6.3e-74 274.6
Cpe14g00975 . 65 256 SNARE and Associated Proteins AT1G32270 60.9 4.7e-53 205.7
Cpe08g00870 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.2e-51 201.1
Cpe01g01046 CCT 1 334 SNARE and Associated Proteins AT5G05760 66.0 5.8e-112 401.4
Cpe01g00138 CCT 1 321 SNARE and Associated Proteins AT5G05760 60.1 3.6e-98 355.5
Cpe11g00567 . 8 340 SNARE and Associated Proteins AT3G24350 65.4 2.4e-103 372.9
Cpe07g00260 . 31 377 SNARE and Associated Proteins AT3G24350 60.2 2.1e-91 333.2
Cpe07g00878 CST 1 327 SNARE and Associated Proteins AT5G26980 75.5 3.9e-126 448.4
Cpe11g00890 CST 1 328 SNARE and Associated Proteins AT5G26980 75.9 1.5e-125 446.4
Cpe12g00911 . 1 287 SNARE and Associated Proteins AT5G26980 64.4 3.3e-88 322.4
Cpe11g00890 CST 1 330 SNARE and Associated Proteins AT4G02195 64.0 2.0e-106 382.9
Cpe07g00878 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.0e-102 369.0
Cpe12g00911 . 1 287 SNARE and Associated Proteins AT4G02195 65.5 1.1e-91 334.0
Cpe11g00890 CST 1 329 SNARE and Associated Proteins AT3G05710 75.1 5.6e-128 454.5
Cpe07g00878 CST 1 328 SNARE and Associated Proteins AT3G05710 74.2 6.2e-127 451.1
Cpe12g00911 . 1 287 SNARE and Associated Proteins AT3G05710 62.0 4.1e-86 315.5
Cpe02g00792 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.8 1.0e-91 333.6
Cpe06g00787 CCT,CST 1 221 SNARE and Associated Proteins AT1G16240 67.0 3.8e-78 288.5
Cpe14g00748 CCT 3 144 SNARE and Associated Proteins AT1G16240 53.5 2.2e-41 166.4
Cpe02g00792 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.4 5.7e-91 331.3
Cpe06g00787 CCT,CST 1 221 SNARE and Associated Proteins AT1G79590 67.8 2.5e-78 289.3
Cpe14g00748 CCT 2 144 SNARE and Associated Proteins AT1G79590 52.4 1.7e-42 170.2
Cpe12g00037 . 110 296 SNARE and Associated Proteins AT1G28490 69.0 1.1e-62 236.9
Cpe03g00174 . 1 264 SNARE and Associated Proteins AT3G09740 77.4 6.6e-111 397.5
Cpe02g00841 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 2.8e-109 392.1
Cpe05g00828 . 1 263 SNARE and Associated Proteins AT3G09740 67.2 3.4e-91 332.0
Cpe03g00174 . 1 264 SNARE and Associated Proteins AT3G45280 62.9 1.1e-86 317.0
Cpe02g00841 . 1 261 SNARE and Associated Proteins AT3G45280 64.0 1.5e-86 316.6
Cpe05g00828 . 1 263 SNARE and Associated Proteins AT3G45280 62.7 1.7e-82 303.1
Cpe02g00841 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 2.2e-95 345.9
Cpe03g00174 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 2.9e-95 345.5
Cpe05g00828 . 1 260 SNARE and Associated Proteins AT3G61450 59.7 4.5e-80 295.0
Cpe01g02531 CCT 122 366 SNARE and Associated Proteins AT1G51740 74.4 6.8e-94 340.9
Cpe13g01079 CCT 171 415 SNARE and Associated Proteins AT1G51740 73.2 4.4e-93 338.2
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63
       

Transcriptome


Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cpe05g00828 Cpe_Chr05 FPKM 0.0 0.0 0.0 0.473094 0.53465 0.578081 0.0 0.0 0.0 0.0