Gene search
Sequence information
| Select | Gene | Cds | Cds_length | GC_content | Pep | Pep_length |
|---|---|---|---|---|---|---|
| Cpe07g00286 | ATGAGCCGCCCTGGAGATTGGAATTGCAGGTCATGCAACCATCTCAACTTCCAACGGAGGGACTCCTGCCACCGCTGTGGCGACCCTAGGGCTGACTTCGGCGGCGCTGCCTACGGCGGCGGAAGAGGTGGTTCTTCCTCGTTTGGGTTCACCACCGGCCCCGACGTCCGCCCTGGCGATTGGTACTGCGCTGTCGCTAACTGCGGCGCTCATAACTTCGCTAGCCGCTCTATCTGCTTCAAGTGCGGCGCCTCCAAGGATGAAGCTTCCGCCGCCGCCTACGACGGCGATTTGTCCCGTATCAGAGGCTTTAACTTCGGCGGTGCCTCCAACCGCCCTGGATGGAAATCTGGTGATTGGATCTGTGCCAGATCAGATTGCAACGAGCATAACTTTGCGAGTCGAAGGGAATGCTTCAGATGCAATGCGCCGAGGGATTCCAACAGCAAGTCACCATACTCGTAG | 465 | 58.71 | MSRPGDWNCRSCNHLNFQRRDSCHRCGDPRADFGGAAYGGGRGGSSSFGFTTGPDVRPGDWYCAVANCGAHNFASRSICFKCGASKDEASAAAYDGDLSRIRGFNFGGASNRPGWKSGDWICARSDCNEHNFASRRECFRCNAPRDSNSKSPYS | 154 |
Gff information
| Chromosome | Start | End | Strand | Old_gene | Gene | Num |
|---|---|---|---|---|---|---|
| 7 | 1891878 | 1893100 | + | Cp4.1LG07g02810.1 | Cpe07g00286 | 472093 |
Annotation
| Select | Seq ID | Length | Analysis | Description | Start | End | IPR | GO |
|---|---|---|---|---|---|---|---|---|
| Cpe07g00286 | 154 | Gene3D | - | 52 | 89 | - | - | |
| Cpe07g00286 | 154 | Gene3D | - | 2 | 32 | - | - | |
| Cpe07g00286 | 154 | Gene3D | - | 109 | 148 | - | - | |
| Cpe07g00286 | 154 | SUPERFAMILY | Ran binding protein zinc finger-like | 2 | 31 | IPR036443 | - | |
| Cpe07g00286 | 154 | PANTHER | ZINC FINGER PROTEIN | 1 | 152 | - | - | |
| Cpe07g00286 | 154 | SMART | zf_4 | 118 | 144 | IPR001876 | - | |
| Cpe07g00286 | 154 | SMART | zf_4 | 59 | 85 | IPR001876 | - | |
| Cpe07g00286 | 154 | SMART | zf_4 | 5 | 29 | IPR001876 | - | |
| Cpe07g00286 | 154 | ProSiteProfiles | Zinc finger RanBP2 type profile. | 57 | 88 | IPR001876 | - | |
| Cpe07g00286 | 154 | ProSitePatterns | Zinc finger RanBP2-type signature. | 61 | 82 | IPR001876 | - | |
| Cpe07g00286 | 154 | SUPERFAMILY | Ran binding protein zinc finger-like | 110 | 148 | IPR036443 | - | |
| Cpe07g00286 | 154 | Pfam | Zn-finger in Ran binding protein and others | 116 | 145 | IPR001876 | - | |
| Cpe07g00286 | 154 | Pfam | Zn-finger in Ran binding protein and others | 3 | 29 | IPR001876 | - | |
| Cpe07g00286 | 154 | Pfam | Zn-finger in Ran binding protein and others | 57 | 86 | IPR001876 | - | |
| Cpe07g00286 | 154 | ProSitePatterns | Zinc finger RanBP2-type signature. | 120 | 141 | IPR001876 | - | |
| Cpe07g00286 | 154 | SUPERFAMILY | Ran binding protein zinc finger-like | 53 | 88 | IPR036443 | - | |
| Cpe07g00286 | 154 | ProSiteProfiles | Zinc finger RanBP2 type profile. | 116 | 147 | IPR001876 | - | |
| Cpe07g00286 | 154 | PANTHER | RAN BP2/NZF ZINC FINGER-LIKE SUPERFAMILY PROTEIN | 1 | 152 | - | - | |
| Cpe07g00286 | 154 | ProSitePatterns | Zinc finger RanBP2-type signature. | 7 | 26 | IPR001876 | - | |
| Cpe07g00286 | 154 | ProSiteProfiles | Zinc finger RanBP2 type profile. | 3 | 32 | IPR001876 | - |
Pathway
| Select | Query | KO | Definition | Second KO | KEGG Genes ID | GHOSTX Score |
|---|---|---|---|---|---|---|
| Cpe07g00286 | - | - | - | csv:101219235 | 303.523 |
WGDs- Genes
| Select | Gene_1 | Gene_2 | Event_name |
|---|---|---|---|
| Cpe07g00286 | Cpe11g00340 | CCT | |
| Cpe07g00286 | Cpe11g00340 | ECH |
Dupl-types
| Select | Gene1 | Location1 | Gene2 | Location2 | E-value | Duplicated-type |
|---|---|---|---|---|---|---|
| Cpe07g00286 | Cpe-Chr7:1891878 | Cpe17g00583 | Cpe-Chr17:4742357 | 1.65E-06 | dispersed | |
| Cpe11g00340 | Cpe-Chr11:1823634 | Cpe07g00286 | Cpe-Chr7:1891878 | 4.00E-81 | wgd | |
| Cpe11g01084 | Cpe-Chr11:9046057 | Cpe07g00286 | Cpe-Chr7:1891878 | 2.81E-12 | wgd | |
| Cpe18g00478 | Cpe-Chr18:5671102 | Cpe07g00286 | Cpe-Chr7:1891878 | 4.73E-33 | wgd | |
| Cpe02g01659 | Cpe-Chr2:13782657 | Cpe07g00286 | Cpe-Chr7:1891878 | 3.64E-12 | wgd |
Deco-Alignment
| Select | Vvi1 | Blo1 | Blo2 | Bda1 | Bda2 | Bpe1 | Bpe2 | Bma1 | Bma2 | Cmo1 | Cmo2 | Cma1 | Cma2 | Car1 | Car2 | Sed1 | Cpe1 | Cpe2 | Bhi1 | Tan1 | Cmetu1 | Lac1 | Hepe1 | Mch1 | Lcy1 | Cla1 | Cam1 | Cec1 | Cco1 | Clacu1 | Cmu1 | Cre1 | Cone1 | Cone2 | Cone3 | Cone4 | Lsi1 | Csa1 | Chy1 | Cme1 | Blo3 | Blo4 | Bda3 | Bda4 | Bpe3 | Bpe4 | Bma3 | Bma4 | Sed2 | Cmo3 | Cmo4 | Cma3 | Cma4 | Car3 | Car4 | Cpe3 | Cpe4 | Bhi2 | Tan2 | Cmetu2 | Lac2 | Hepe2 | Mch2 | Lcy2 | Cla2 | Cam2 | Cec2 | Cco2 | Clacu2 | Cmu2 | Cre2 | Lsi2 | Csa2 | Chy2 | Cme2 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Vvi4g452 | Blo01g01377 | . | Bda01g00734 | . | . | Bpe02g00572 | . | . | Cmo05g00409 | Cmo12g00277 | . | Cma05g00396 | . | Car12g00309 | Sed01g1363 | Cpe07g00286 | . | Bhi04g00986 | Tan02g2707 | Cmetu03g1356 | . | . | . | Lcy13g1766 | . | . | . | . | . | . | . | Cone4ag1804 | Cone7ag1712 | . | . | . | . | . | Cme03g01640 | . | . | . | . | . | . | . | . | . | . | . | . | Cma12g00327 | . | Car05g00333 | Cpe11g00340 | . | . | . | . | . | . | . | . | Cla08g01315 | Cam08g1775 | Cec08g1357 | Cco08g1477 | Clacu08g1471 | . | Cre08g1258 | Lsi08g01180 | . | Chy03g01140 | . |
Syn-Orthogroups
| Select | Orthogroup | Bda | Bhi | Blo | Bma | Bpe | Cam | Car | Cco | Cec | Chy | Cla | Clacu | Cma | Cme | Cmetu | Cmo | Cmu | Cone | Cpe | Cre | Csa | HCH | Hepe | Lac | Lcy | Lsi | Mch | Sed | Tan | Vvi | Total |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| OG0001025 | 2 | 6 | 2 | 1 | 2 | 1 | 5 | 2 | 2 | 2 | 1 | 1 | 4 | 3 | 3 | 5 | 2 | 4 | 4 | 1 | 2 | 3 | 3 | 2 | 3 | 2 | 3 | 5 | 5 | 2 | 83 |
Transcriptome
| Select | Gene | Chr | Type | da1 | da2 | da3 | da4 | da5 | da6 | da7 | da8 | da9 | da10 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Cpe07g00286 | Cpe_Chr07 | FPKM | 48.700821 | 53.610435 | 33.889282 | 27.541124 | 22.294188 | 27.595245 | 21.52545 | 47.495449 | 48.953335 | 47.946327 |