Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cpe11g00890 ATGGCGTCGAGGAATCGGACTTTGATTTTTAGGAAATACAGGGACGCGTTGAGGAGTGTGAGGGTTCCTACCGGCTCTTCGCCTGCTTCTGCATCGCCATCGACTAGCTCTGGCACTGGTGGACCGGTGATTGAATTGGTTAGCTCGTCGTTGTTGCATCCGAATCGGTCGTACGCTCCCTTAAGTACTGAGGATCCGGGTAATTCAAGTAAGGGTGCTCTTACTGTGGGTCTACCTCCGGCTTGGGTGGATGTATCCGAAGAAATAGCTGCAAATGTGCAGCGTGCACGAGTAAAGATGATGGAGTTAGCTAAAGCTCATGCAAAGGCTTTAATGCCTTCATTTGGAGATGATAAAGAAGATCAACGGTTAATTGAATCTCTCACGCAAGACATAACTAACTTAATCAAGAAATCGGAGAAGGGGCTCAAGAGATTTTCCGTAGCTGGACCTTCAGAAGATTCCAATATCAGAAAAAATGTTCAGCGATCTCTTGCCACTGACCTTCAGAACCTCTCCATGGAGCTTCGCAAGAAACAATCAACTTATTTAAAGCGCCTACGGCAGCAAAAAGAGGGAGGTCAAGATGGGATTGACATAGAGATGAATCTAAATGGAAACAGGTCGAGAATGGAGGAGGACGATGATTTAGAAGACATGGTATTTAACGAGCATCAGATGGCTAAGGTGCGTAAGACTGAAGCATTCACCGCAGAAAGAGAGAGAGAGATCCAACAAGTAGTAGAATCCGTGAACGAGCTCGCTCAGATCATGAAGGATCTATCGGTACTTGTCATAGACCAGGGTACCATTATCGATAGAATAGATTACAATATCCAAAATGTTGCGACGACGGTCGAGGAGGGCCTTAAGCAACTGCAGAAGGCGGAGAGAACACAGAAACAAGGGGGGATGGTAATGTGCGCGTCCGTGCTCATTATCATGTGCTTCGTCATGTTGGTTCTCTTAATCCTTAAATCCATCCTATTTTGA 993 45.92 MASRNRTLIFRKYRDALRSVRVPTGSSPASASPSTSSGTGGPVIELVSSSLLHPNRSYAPLSTEDPGNSSKGALTVGLPPAWVDVSEEIAANVQRARVKMMELAKAHAKALMPSFGDDKEDQRLIESLTQDITNLIKKSEKGLKRFSVAGPSEDSNIRKNVQRSLATDLQNLSMELRKKQSTYLKRLRQQKEGGQDGIDIEMNLNGNRSRMEEDDDLEDMVFNEHQMAKVRKTEAFTAEREREIQQVVESVNELAQIMKDLSVLVIDQGTIIDRIDYNIQNVATTVEEGLKQLQKAERTQKQGGMVMCASVLIIMCFVMLVLLILKSILF 330
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
11 7181930 7186151 - Cp4.1LG11g08910.1 Cpe11g00890 477684

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cpe11g00890 330 MobiDBLite consensus disorder prediction 21 44 - -
Cpe11g00890 330 ProSitePatterns Syntaxin / epimorphin family signature. 240 279 IPR006012 GO:0005484|GO:0006886|GO:0016020
Cpe11g00890 330 CDD SNARE_syntaxin16 238 295 - -
Cpe11g00890 330 Pfam SNARE domain 270 322 IPR000727 -
Cpe11g00890 330 SMART tSNARE_6 229 296 IPR000727 -
Cpe11g00890 330 Gene3D - 79 288 - -
Cpe11g00890 330 PANTHER SYNTAXIN-43-LIKE 1 325 - -
Cpe11g00890 330 SMART SynN_4 73 188 IPR006011 GO:0016020
Cpe11g00890 330 PANTHER SYNTAXIN 1 325 IPR045242 -
Cpe11g00890 330 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 234 296 IPR000727 -
Cpe11g00890 330 MobiDBLite consensus disorder prediction 23 44 - -
Cpe11g00890 330 SUPERFAMILY t-snare proteins 78 289 IPR010989 GO:0016020|GO:0016192
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cpe11g00890 K08489 STX16; syntaxin 16 - csv:101207998 575.474
       

WGDs- Genes

Select Gene_1 Gene_2 Event_name
Cpe07g00878 Cpe11g00890 CST
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cpe08g00870 Cpe-Chr8:6869032 Cpe11g00890 Cpe-Chr11:7181930 1.77E-13 dispersed
Cpe11g00890 Cpe-Chr11:7181930 Cpe14g00975 Cpe-Chr14:8249458 4.54E-11 dispersed
Cpe12g00911 Cpe-Chr12:7883999 Cpe11g00890 Cpe-Chr11:7181930 4.03E-124 transposed
Cpe11g00890 Cpe-Chr11:7181930 Cpe07g00878 Cpe-Chr7:7899543 0 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi14g133 . . . . . . . . . . Cma05g01087 Cma12g01045 Car05g00958 Car12g01004 . Cpe07g00878 Cpe11g00890 . . . . . . . Cla02g01497 Cam02g1577 Cec02g1601 Cco02g1642 Clacu02g1560 Cmu02g1513 Cre02g1836 Cone10ag0804 Cone3ag0826 . . . Csa02g00478 . Cme05g01576 . . Bda01g01638 . . . . Bma05g00265 Sed11g0396 Cmo05g01102 Cmo12g01056 . . . . . . Bhi06g01461 Tan08g0631 Cmetu05g1168 . Hepe08g2281 . . . . . . . . . Lsi11g00612 . Chy05g01060 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cpe11g00567 . 8 340 SNARE and Associated Proteins AT3G24350 65.4 2.4e-103 372.9
Cpe07g00260 . 31 377 SNARE and Associated Proteins AT3G24350 60.2 2.1e-91 333.2
Cpe19g00189 . 1 308 SNARE and Associated Proteins AT1G08560 68.5 6.5e-102 367.9
Cpe10g01038 CST 1 312 SNARE and Associated Proteins AT1G08560 68.0 6.3e-97 351.3
Cpe10g00620 . 10 311 SNARE and Associated Proteins AT2G18260 53.6 1.8e-83 306.6
Cpe03g00316 . 19 279 SNARE and Associated Proteins AT3G11820 81.6 2.1e-116 416.0
Cpe08g00962 CST 19 279 SNARE and Associated Proteins AT3G11820 77.4 1.0e-110 397.1
Cpe19g00503 . 21 278 SNARE and Associated Proteins AT3G11820 70.2 4.0e-99 358.6
Cpe20g00409 . 31 281 SNARE and Associated Proteins AT3G11820 66.1 1.8e-91 333.2
Cpe03g00938 . 27 285 SNARE and Associated Proteins AT3G11820 52.1 5.6e-69 258.5
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT3G52400 64.3 6.1e-93 338.2
Cpe08g00962 CST 1 279 SNARE and Associated Proteins AT3G52400 61.5 5.9e-88 321.6
Cpe19g00503 . 1 277 SNARE and Associated Proteins AT3G52400 59.4 1.4e-84 310.5
Cpe20g00409 . 1 281 SNARE and Associated Proteins AT3G52400 56.5 2.4e-81 299.7
Cpe20g00409 . 1 299 SNARE and Associated Proteins AT4G03330 67.5 1.1e-106 383.6
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT4G03330 57.5 1.9e-82 303.1
Cpe08g00962 CST 1 284 SNARE and Associated Proteins AT4G03330 56.6 9.6e-82 300.8
Cpe19g00503 . 1 278 SNARE and Associated Proteins AT4G03330 52.8 3.9e-75 278.9
Cpe03g00938 . 1 285 SNARE and Associated Proteins AT4G03330 52.3 1.4e-69 260.4
Cpe20g00409 . 1 303 SNARE and Associated Proteins AT1G61290 76.9 1.8e-125 446.0
Cpe08g00962 CST 1 294 SNARE and Associated Proteins AT1G61290 59.8 2.3e-91 332.8
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT1G61290 61.9 4.3e-90 328.6
Cpe19g00503 . 1 296 SNARE and Associated Proteins AT1G61290 54.9 2.8e-81 299.3
Cpe09g00868 . 1 220 SNARE and Associated Proteins AT1G61290 56.1 7.6e-79 291.2
Cpe20g00409 . 1 303 SNARE and Associated Proteins AT1G11250 76.2 1.1e-122 436.8
Cpe08g00962 CST 1 294 SNARE and Associated Proteins AT1G11250 60.2 6.3e-94 341.3
Cpe03g00316 . 1 279 SNARE and Associated Proteins AT1G11250 62.7 2.4e-93 339.3
Cpe19g00503 . 1 291 SNARE and Associated Proteins AT1G11250 54.6 1.9e-82 303.1
Cpe09g00868 . 1 220 SNARE and Associated Proteins AT1G11250 56.4 9.1e-77 284.3
Cpe03g00938 . 1 285 SNARE and Associated Proteins AT1G11250 50.5 3.7e-70 262.3
Cpe03g00938 . 1 308 SNARE and Associated Proteins AT3G03800 74.0 1.9e-117 419.5
Cpe03g00938 . 1 203 SNARE and Associated Proteins AT5G08080 77.3 7.8e-81 297.4
Cpe16g00449 CST 2 149 SNARE and Associated Proteins AT5G08080 56.5 2.7e-41 166.0
Cpe08g00870 . 1 256 SNARE and Associated Proteins AT5G16830 59.9 9.4e-76 280.8
Cpe14g00975 . 1 256 SNARE and Associated Proteins AT5G16830 59.9 9.4e-76 280.8
Cpe08g00870 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 2.5e-81 299.3
Cpe14g00975 . 1 256 SNARE and Associated Proteins AT5G46860 66.8 1.2e-80 297.0
Cpe08g00870 . 1 256 SNARE and Associated Proteins AT4G17730 61.3 2.8e-74 275.8
Cpe14g00975 . 1 256 SNARE and Associated Proteins AT4G17730 61.7 6.3e-74 274.6
Cpe14g00975 . 65 256 SNARE and Associated Proteins AT1G32270 60.9 4.7e-53 205.7
Cpe08g00870 . 65 256 SNARE and Associated Proteins AT1G32270 60.4 1.2e-51 201.1
Cpe01g01046 CCT 1 334 SNARE and Associated Proteins AT5G05760 66.0 5.8e-112 401.4
Cpe01g00138 CCT 1 321 SNARE and Associated Proteins AT5G05760 60.1 3.6e-98 355.5
Cpe11g00567 . 8 340 SNARE and Associated Proteins AT3G24350 65.4 2.4e-103 372.9
Cpe07g00260 . 31 377 SNARE and Associated Proteins AT3G24350 60.2 2.1e-91 333.2
Cpe07g00878 CST 1 327 SNARE and Associated Proteins AT5G26980 75.5 3.9e-126 448.4
Cpe11g00890 CST 1 328 SNARE and Associated Proteins AT5G26980 75.9 1.5e-125 446.4
Cpe12g00911 . 1 287 SNARE and Associated Proteins AT5G26980 64.4 3.3e-88 322.4
Cpe11g00890 CST 1 330 SNARE and Associated Proteins AT4G02195 64.0 2.0e-106 382.9
Cpe07g00878 CST 1 329 SNARE and Associated Proteins AT4G02195 62.8 3.0e-102 369.0
Cpe12g00911 . 1 287 SNARE and Associated Proteins AT4G02195 65.5 1.1e-91 334.0
Cpe11g00890 CST 1 329 SNARE and Associated Proteins AT3G05710 75.1 5.6e-128 454.5
Cpe07g00878 CST 1 328 SNARE and Associated Proteins AT3G05710 74.2 6.2e-127 451.1
Cpe12g00911 . 1 287 SNARE and Associated Proteins AT3G05710 62.0 4.1e-86 315.5
Cpe02g00792 CCT,CST 1 233 SNARE and Associated Proteins AT1G16240 73.8 1.0e-91 333.6
Cpe06g00787 CCT,CST 1 221 SNARE and Associated Proteins AT1G16240 67.0 3.8e-78 288.5
Cpe14g00748 CCT 3 144 SNARE and Associated Proteins AT1G16240 53.5 2.2e-41 166.4
Cpe02g00792 CCT,CST 1 233 SNARE and Associated Proteins AT1G79590 73.4 5.7e-91 331.3
Cpe06g00787 CCT,CST 1 221 SNARE and Associated Proteins AT1G79590 67.8 2.5e-78 289.3
Cpe14g00748 CCT 2 144 SNARE and Associated Proteins AT1G79590 52.4 1.7e-42 170.2
Cpe12g00037 . 110 296 SNARE and Associated Proteins AT1G28490 69.0 1.1e-62 236.9
Cpe03g00174 . 1 264 SNARE and Associated Proteins AT3G09740 77.4 6.6e-111 397.5
Cpe02g00841 . 1 261 SNARE and Associated Proteins AT3G09740 77.6 2.8e-109 392.1
Cpe05g00828 . 1 263 SNARE and Associated Proteins AT3G09740 67.2 3.4e-91 332.0
Cpe03g00174 . 1 264 SNARE and Associated Proteins AT3G45280 62.9 1.1e-86 317.0
Cpe02g00841 . 1 261 SNARE and Associated Proteins AT3G45280 64.0 1.5e-86 316.6
Cpe05g00828 . 1 263 SNARE and Associated Proteins AT3G45280 62.7 1.7e-82 303.1
Cpe02g00841 . 1 261 SNARE and Associated Proteins AT3G61450 69.3 2.2e-95 345.9
Cpe03g00174 . 1 261 SNARE and Associated Proteins AT3G61450 68.9 2.9e-95 345.5
Cpe05g00828 . 1 260 SNARE and Associated Proteins AT3G61450 59.7 4.5e-80 295.0
Cpe01g02531 CCT 122 366 SNARE and Associated Proteins AT1G51740 74.4 6.8e-94 340.9
Cpe13g01079 CCT 171 415 SNARE and Associated Proteins AT1G51740 73.2 4.4e-93 338.2
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003497 3 1 2 2 1 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 4 4 2 46
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Cpe11g00890 Cpe_Chr11 FPKM 19.353659 20.566719 12.364988 14.154941 28.344614 31.943829 30.264278 20.989861 21.327036 21.800322