Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cre02g2412 ATGACCGTAATCGACATCATCTTCCGAGTCGATTCCATTTGCAAGAAATATGAGAAGTATGATGTCGAGAAACAGCGTGAACTCAATGCTTATGGTGACGATGCCTTTGCTCGCCTCTTCGCCGCCGTCGAACTCGAAATCGACGCCGCTCTCCAGAAATCTGAGGCTGCCTCAACTGAGAAGAATAGAGCTGCTGCAGTTGCAATGAACGCTGAGGTTCGACGGAAGAAGGCTCGATTGATGGATGAAGTCCCTAAGCTTCGTAAATTGGCTCATAAGAAGGTTAAAGGGGTTCCGAAAGAAGAGCTGGAGGTCAGAGATGATCTTGTTCTTGCGCTTGAAGAGAAGATTAAAGCCATACCAGATGGGAGTACCTCAGGAGCCAAACAATCTGGGGGATGGGGGTCCTCCTCCTCATCTAACAATATCAAGTTTGATTCATCAGATGGAAACTTTGAGAGCGAGTATTTCCAGCAAAGTGAAGAATCAAGCCAATTTCGAAATGAGTATGAAATGCGGAAGATGAAACAGGACCAAGGTCTCGATGTCATATCTGAAGGTTTGGATATGCTGAAAAATCTAGCCCATGACATGAATGAGGAATTGGACAGGCAAGTTCCATTAATCGACGAGATCGACGCAAAGGTAGACAAGGTGACTGATGAGATTAAAAATACCAATGTTAGGCTCAAGGAAACGCTCTATGAGGTGAGATCCAGCCAAAACTTCTGCATTGATATTATTCTTCTCTGTATAATTCTTGGAATTGCTTCTTACTTGTACAATATATTGAGCTGA 798 43.86 MTVIDIIFRVDSICKKYEKYDVEKQRELNAYGDDAFARLFAAVELEIDAALQKSEAASTEKNRAAAVAMNAEVRRKKARLMDEVPKLRKLAHKKVKGVPKEELEVRDDLVLALEEKIKAIPDGSTSGAKQSGGWGSSSSSNNIKFDSSDGNFESEYFQQSEESSQFRNEYEMRKMKQDQGLDVISEGLDMLKNLAHDMNEELDRQVPLIDEIDAKVDKVTDEIKNTNVRLKETLYEVRSSQNFCIDIILLCIILGIASYLYNILS 265
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 37509939 37512310 + CrPI670011_02g024120.1 Cre02g2412 491693

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cre02g2412 265 Coils Coil 209 229 - -
Cre02g2412 265 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 171 233 IPR000727 -
Cre02g2412 265 MobiDBLite consensus disorder prediction 124 145 - -
Cre02g2412 265 CDD SNARE_Qc 176 232 - -
Cre02g2412 265 PANTHER SYNTAXIN 45 251 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0006886(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cre02g2412 265 Pfam SNARE domain 208 257 IPR000727 -
Cre02g2412 265 FunFam Putative syntaxin-71-like 171 232 - -
Cre02g2412 265 ProSitePatterns Syntaxin / epimorphin family signature. 177 216 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cre02g2412 265 Gene3D - 171 232 - -
Cre02g2412 265 MobiDBLite consensus disorder prediction 122 145 - -
Cre02g2412 265 SMART tSNARE_6 166 233 IPR000727 -
Cre02g2412 265 SUPERFAMILY SNARE fusion complex 167 231 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cre02g2412 K08506 - - csv:101211289 448.358
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cre10g2153 Cre-Chr10:36078053 Cre02g2412 Cre-Chr2:37509939 3.30E-100 wgd
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi6g289 . . Bda02g00767 . Bpe01g00179 . . . . . . . . . . Cpe05g00828 . . . . . . . . Cla02g02052 Cam02g2177 Cec02g2216 Cco02g2256 Clacu02g2162 Cmu02g2099 Cre02g2412 . Cone5ag1222 . . . . . Cme11g01789 . Blo14g00167 . . . . . Bma11g00164 Sed05g2859 Cmo02g00885 Cmo20g00513 Cma02g00885 . . Car20g00420 . . Bhi10g00561 Tan05g0265 Cmetu11g0284 . Hepe08g0878 . . . . . . . . . . . . .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cre08g1226 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 6.3e-87 318.2
Cre04g0696 . 1 309 SNARE and Associated Proteins AT1G08560 69.0 7.3e-100 360.9
Cre04g1576 . 557 859 SNARE and Associated Proteins AT2G18260 55.5 2.4e-87 319.3
Cre10g1939 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.7e-115 411.8
Cre04g1143 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 2.5e-103 372.5
Cre03g0844 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 2.0e-92 336.3
Cre10g1499 . 30 284 SNARE and Associated Proteins AT3G11820 52.9 4.0e-69 258.8
Cre10g1939 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 6.2e-92 334.7
Cre04g1143 . 33 282 SNARE and Associated Proteins AT3G52400 65.2 6.6e-86 314.7
Cre03g0844 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 6.4e-81 298.1
Cre03g0844 . 1 299 SNARE and Associated Proteins AT4G03330 68.9 1.2e-107 386.7
Cre10g1939 . 1 284 SNARE and Associated Proteins AT4G03330 57.2 3.2e-84 308.9
Cre04g1143 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 2.4e-79 292.7
Cre10g1499 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 1.3e-69 260.4
Cre03g0844 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 1.8e-127 452.6
Cre10g1939 . 1 284 SNARE and Associated Proteins AT1G61290 62.0 2.7e-91 332.4
Cre04g1143 . 1 297 SNARE and Associated Proteins AT1G61290 56.9 4.5e-86 315.1
Cre03g0844 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 3.1e-124 441.8
Cre10g1939 . 1 284 SNARE and Associated Proteins AT1G11250 62.0 1.7e-93 339.7
Cre04g1143 . 1 292 SNARE and Associated Proteins AT1G11250 57.5 3.1e-87 318.9
Cre10g1499 . 1 303 SNARE and Associated Proteins AT3G03800 74.3 1.0e-114 410.2
Cre02g1184 . 1 304 SNARE and Associated Proteins AT3G03800 54.8 6.1e-83 304.7
Cre10g1499 . 1 202 SNARE and Associated Proteins AT5G08080 79.3 3.2e-81 298.5
Cre02g1184 . 1 204 SNARE and Associated Proteins AT5G08080 59.3 8.8e-55 210.7
Cre10g0399 . 1 261 SNARE and Associated Proteins AT5G16830 59.6 2.7e-77 285.8
Cre10g0399 . 1 261 SNARE and Associated Proteins AT5G46860 66.7 3.5e-82 302.0
Cre10g0399 . 1 257 SNARE and Associated Proteins AT4G17730 60.7 1.7e-73 273.1
Cre10g0399 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 4.8e-52 202.2
Cre07g0761 . 84 419 SNARE and Associated Proteins AT5G05760 65.9 1.2e-111 400.2
Cre08g1226 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 6.3e-87 318.2
Cre02g1836 . 1 327 SNARE and Associated Proteins AT5G26980 76.8 5.0e-128 454.5
Cre09g0524 . 1 317 SNARE and Associated Proteins AT5G26980 66.2 6.9e-101 364.4
Cre02g1836 . 1 329 SNARE and Associated Proteins AT4G02195 64.4 3.5e-105 378.6
Cre09g0524 . 1 317 SNARE and Associated Proteins AT4G02195 66.8 3.9e-104 375.2
Cre02g1836 . 1 328 SNARE and Associated Proteins AT3G05710 76.3 4.2e-130 461.5
Cre09g0524 . 1 317 SNARE and Associated Proteins AT3G05710 63.7 2.8e-97 352.4
Cre09g1057 . 92 324 SNARE and Associated Proteins AT1G16240 72.1 2.6e-89 325.5
Cre10g0700 . 979 1200 SNARE and Associated Proteins AT1G16240 68.9 9.7e-81 297.0
Cre09g1057 . 91 324 SNARE and Associated Proteins AT1G79590 71.4 4.2e-88 321.6
Cre10g0700 . 974 1200 SNARE and Associated Proteins AT1G79590 67.4 4.5e-82 301.6
Cre06g0825 . 176 366 SNARE and Associated Proteins AT1G28490 71.7 9.0e-67 250.4
Cre10g2153 . 51 314 SNARE and Associated Proteins AT3G09740 79.7 2.9e-113 405.2
Cre02g2412 . 1 265 SNARE and Associated Proteins AT3G09740 67.8 1.6e-95 346.3
Cre02g2412 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 8.3e-92 334.0
Cre10g2153 . 51 314 SNARE and Associated Proteins AT3G45280 64.4 9.4e-88 320.5
Cre10g2153 . 51 311 SNARE and Associated Proteins AT3G61450 68.2 7.8e-95 344.0
Cre02g2412 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 3.3e-85 312.0
Cre11g1122 . 65 309 SNARE and Associated Proteins AT1G51740 72.5 2.4e-90 328.9
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0002038 1 2 1 1 1 2 3 2 2 2 2 2 3 3 2 3 2 2 3 2 3 2 2 2 2 2 3 2 2 2 63