Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cre04g0696 ATGAACGACTTGATGACCAAATCGTTCACCAGCTATGTGGATCTGAAGAAGGCAGCCATGAAAGATCTCGACCTCGAAGCTGGTTTAGAAATGCCATCGTCCGCTACCGGAGACAACGGTGACATGGGTCTTTTTCTCGAAGAAGCTGAGAAGGTGAAAATGGAGATGGGTTCAATTAGAGAGATTTTAGTTAAACTCCAACAAGCTAATGAGGAGACCAAATCTGCTCACAAACCCGAAACTCTCAAATTGCTTCGTAATACGATCAATGTCGACATCGTCACCGTCCTGAAAAAGGCGCGATTGATCCGATCTCAGCTTGAGGAAATGGACCGTGCCAATGCTGCAAAGAAACGTCTTTCTGGCAGCAAAGAAGGCACTGCCATTTACCGGACGAGAATTGCGGTGACAAACGGGCTGCGGAAGAAGCTAAAGGAATTGATGATGGAGTTTCAGAGCTTGAGGCAGAGGATGATGACGGAGTACAAGGAAACGGTCGGGCGACGGTATTTCACAGTGACGGGGGAGCATCCAGAGGAGGAGGTGATAGAGAAGATAATATCCAATGGAGGAGAGGAGTTTTTGGGGAGGGCAATAGAGGAGCACGGGCGGGGGAAAGTGGCGGAGACGGTGGTGGAGATACAAGACCGACACGGGGCGGCGAAGGAGATAGAGAAGAGTTTGCTAGAGCTACACCAAGTGTTTTTGGATATGGCAGTGATGGTTGAAGCACAAGGGGAAAAAATGGATGATATTGAACATCATGTGATGAATGCTTCACAATATGTTAGGGATGGGACTAAGGATTTGAAGACTGCAAAAGATTTGCAAAGGAACAGTAGGAAATGTATGTGTTTTGGGATTTTTCTTTTGCTTCTGATTATTTTGGTTGTTGTTATTCCTATTGCTGTTAGTTTTGGAAGTTCTTGA 930 46.02 MNDLMTKSFTSYVDLKKAAMKDLDLEAGLEMPSSATGDNGDMGLFLEEAEKVKMEMGSIREILVKLQQANEETKSAHKPETLKLLRNTINVDIVTVLKKARLIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEHPEEEVIEKIISNGGEEFLGRAIEEHGRGKVAETVVEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDDIEHHVMNASQYVRDGTKDLKTAKDLQRNSRKCMCFGIFLLLLIILVVVIPIAVSFGSS 309
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 24920787 24921791 - CrPI670011_04g006960.1 Cre04g0696 495000

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cre04g0696 309 CDD SNARE_syntaxin1-like 210 272 - -
Cre04g0696 309 Pfam SNARE domain 248 299 IPR000727 -
Cre04g0696 309 FunFam Qa-SNARE, Sso1/Syntaxin1-type, SYP12A-group 39 169 - -
Cre04g0696 309 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 211 273 IPR000727 -
Cre04g0696 309 FunFam Syntaxin 132 204 304 - -
Cre04g0696 309 SUPERFAMILY t-snare proteins 41 266 IPR010989 GO:0016020(InterPro)|GO:0016192(InterPro)
Cre04g0696 309 Gene3D - 37 166 - -
Cre04g0696 309 SMART tSNARE_6 206 273 IPR000727 -
Cre04g0696 309 SMART SynN_4 37 163 IPR006011 GO:0016020(InterPro)
Cre04g0696 309 CDD SynN 42 198 IPR006011 GO:0016020(InterPro)
Cre04g0696 309 Pfam Syntaxin 45 246 IPR006011 GO:0016020(InterPro)
Cre04g0696 309 PANTHER SYNTAXIN 48 294 IPR045242 GO:0000149(PANTHER)|GO:0005484(PANTHER)|GO:0005886(PANTHER)|GO:0006886(PANTHER)|GO:0006887(PANTHER)|GO:0006906(PANTHER)|GO:0012505(PANTHER)|GO:0016021(PANTHER)|GO:0031201(PANTHER)|GO:0048278(PANTHER)
Cre04g0696 309 ProSitePatterns Syntaxin / epimorphin family signature. 217 257 IPR006012 GO:0005484(InterPro)|GO:0006886(InterPro)|GO:0016020(InterPro)
Cre04g0696 309 Coils Coil 137 157 - -
Cre04g0696 309 Gene3D - 206 307 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cre04g0696 K08486 - - csv:101220775 565.459
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cre04g0696 Cre-Chr4:24920787 Cre10g1939 Cre-Chr10:34055389 7.40E-60 dispersed
Cre04g0696 Cre-Chr4:24920787 Cre04g1143 Cre-Chr4:30039475 4.30E-60 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cre08g1226 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 6.3e-87 318.2
Cre04g0696 . 1 309 SNARE and Associated Proteins AT1G08560 69.0 7.3e-100 360.9
Cre04g1576 . 557 859 SNARE and Associated Proteins AT2G18260 55.5 2.4e-87 319.3
Cre10g1939 . 19 279 SNARE and Associated Proteins AT3G11820 80.8 3.7e-115 411.8
Cre04g1143 . 26 282 SNARE and Associated Proteins AT3G11820 73.2 2.5e-103 372.5
Cre03g0844 . 31 281 SNARE and Associated Proteins AT3G11820 66.5 2.0e-92 336.3
Cre10g1499 . 30 284 SNARE and Associated Proteins AT3G11820 52.9 4.0e-69 258.8
Cre10g1939 . 1 279 SNARE and Associated Proteins AT3G52400 63.9 6.2e-92 334.7
Cre04g1143 . 33 282 SNARE and Associated Proteins AT3G52400 65.2 6.6e-86 314.7
Cre03g0844 . 1 281 SNARE and Associated Proteins AT3G52400 56.4 6.4e-81 298.1
Cre03g0844 . 1 299 SNARE and Associated Proteins AT4G03330 68.9 1.2e-107 386.7
Cre10g1939 . 1 284 SNARE and Associated Proteins AT4G03330 57.2 3.2e-84 308.9
Cre04g1143 . 1 297 SNARE and Associated Proteins AT4G03330 52.6 2.4e-79 292.7
Cre10g1499 . 1 284 SNARE and Associated Proteins AT4G03330 52.4 1.3e-69 260.4
Cre03g0844 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 1.8e-127 452.6
Cre10g1939 . 1 284 SNARE and Associated Proteins AT1G61290 62.0 2.7e-91 332.4
Cre04g1143 . 1 297 SNARE and Associated Proteins AT1G61290 56.9 4.5e-86 315.1
Cre03g0844 . 1 299 SNARE and Associated Proteins AT1G11250 78.3 3.1e-124 441.8
Cre10g1939 . 1 284 SNARE and Associated Proteins AT1G11250 62.0 1.7e-93 339.7
Cre04g1143 . 1 292 SNARE and Associated Proteins AT1G11250 57.5 3.1e-87 318.9
Cre10g1499 . 1 303 SNARE and Associated Proteins AT3G03800 74.3 1.0e-114 410.2
Cre02g1184 . 1 304 SNARE and Associated Proteins AT3G03800 54.8 6.1e-83 304.7
Cre10g1499 . 1 202 SNARE and Associated Proteins AT5G08080 79.3 3.2e-81 298.5
Cre02g1184 . 1 204 SNARE and Associated Proteins AT5G08080 59.3 8.8e-55 210.7
Cre10g0399 . 1 261 SNARE and Associated Proteins AT5G16830 59.6 2.7e-77 285.8
Cre10g0399 . 1 261 SNARE and Associated Proteins AT5G46860 66.7 3.5e-82 302.0
Cre10g0399 . 1 257 SNARE and Associated Proteins AT4G17730 60.7 1.7e-73 273.1
Cre10g0399 . 65 256 SNARE and Associated Proteins AT1G32270 59.9 4.8e-52 202.2
Cre07g0761 . 84 419 SNARE and Associated Proteins AT5G05760 65.9 1.2e-111 400.2
Cre08g1226 . 8 363 SNARE and Associated Proteins AT3G24350 55.8 6.3e-87 318.2
Cre02g1836 . 1 327 SNARE and Associated Proteins AT5G26980 76.8 5.0e-128 454.5
Cre09g0524 . 1 317 SNARE and Associated Proteins AT5G26980 66.2 6.9e-101 364.4
Cre02g1836 . 1 329 SNARE and Associated Proteins AT4G02195 64.4 3.5e-105 378.6
Cre09g0524 . 1 317 SNARE and Associated Proteins AT4G02195 66.8 3.9e-104 375.2
Cre02g1836 . 1 328 SNARE and Associated Proteins AT3G05710 76.3 4.2e-130 461.5
Cre09g0524 . 1 317 SNARE and Associated Proteins AT3G05710 63.7 2.8e-97 352.4
Cre09g1057 . 92 324 SNARE and Associated Proteins AT1G16240 72.1 2.6e-89 325.5
Cre10g0700 . 979 1200 SNARE and Associated Proteins AT1G16240 68.9 9.7e-81 297.0
Cre09g1057 . 91 324 SNARE and Associated Proteins AT1G79590 71.4 4.2e-88 321.6
Cre10g0700 . 974 1200 SNARE and Associated Proteins AT1G79590 67.4 4.5e-82 301.6
Cre06g0825 . 176 366 SNARE and Associated Proteins AT1G28490 71.7 9.0e-67 250.4
Cre10g2153 . 51 314 SNARE and Associated Proteins AT3G09740 79.7 2.9e-113 405.2
Cre02g2412 . 1 265 SNARE and Associated Proteins AT3G09740 67.8 1.6e-95 346.3
Cre02g2412 . 1 265 SNARE and Associated Proteins AT3G45280 65.9 8.3e-92 334.0
Cre10g2153 . 51 314 SNARE and Associated Proteins AT3G45280 64.4 9.4e-88 320.5
Cre10g2153 . 51 311 SNARE and Associated Proteins AT3G61450 68.2 7.8e-95 344.0
Cre02g2412 . 1 262 SNARE and Associated Proteins AT3G61450 61.4 3.3e-85 312.0
Cre11g1122 . 65 309 SNARE and Associated Proteins AT1G51740 72.5 2.4e-90 328.9
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32