Gene search


Sequence information


Select Gene Cds Cds_length GC_content Pep Pep_length
Cre04g0775 ATGGCCACAAGCGTCTCGCACTCTCCCGATTTCCGCCCTGAAGTTTCAGTTCCGCCGCCGACCCATGACGGCCTTTACTTCTGGCAATTCATGATCGCCGGGTCAATTGCAGGGTCGGTCGAGCACATGGCGATGTATCCAGTGGACACTCTCAAGACCCGAATACAAGCCCTCGGCGGCGGATCGTCAACAGTCCGACAAGCACTCGGCTCGATTCTGAAGGTGGAAGGTCCGGCAGGGCTCTACCGTGGAATCGGAGCAATGGGTTTGGGAGCAGGACCTGCACACGCAGTCTATTTCTCAGTGTATGAGTTTTGCAAAGAAGGCTTTTCAATGGGAAATAACAACAACCCATTAGCGCACGCCATTGCTGGAGTTTGTGCGACGGTGACGAGCGACGCGGTGATAACACCGATGGATGTGGTGAAACAGAGGCTGCAGTTGAAGAGCAGTCCTTATAAAGGGGTGGGAGAGTGTGTGAGGAGGATTTTGGTTGAGGAAGGAATTGGGGCGCTGTATGCCTCTTATCGGACGACGGTTGTGATGAACGCACCGTATACGGCGGTGTATTTTGCGACTTATGAAGCTGCAAAAAGGGGATTGAAGGAGGTTTCACTGGGAAGTGACAACGATGAGAGGCTGATTGTTCATGCTACGGCTGGTGCGGCAGCTGGGTCTCTTGCTGCTGCTCTTACAACGCCATTAGACGTCGTGAAAACTCGGCTGCAATGCCAGGGAGTATGTGGTTGCGACAAATTTTCAAGCAGTTCAATTGGGTACGTACTTGGTTGTGTAGTGAAGAAAGACGGCTACAGTGGGCTGATGAAGGGATGGATTCCAAGGATGATGTTCCATGCCCCTGCTGCTGCAATTTGCTGGTCCACTTATGAGGCTTCAAAAACCTTCTTTCAACATCTCCACAATGACAACAATTAG 936 51.82 MATSVSHSPDFRPEVSVPPPTHDGLYFWQFMIAGSIAGSVEHMAMYPVDTLKTRIQALGGGSSTVRQALGSILKVEGPAGLYRGIGAMGLGAGPAHAVYFSVYEFCKEGFSMGNNNNPLAHAIAGVCATVTSDAVITPMDVVKQRLQLKSSPYKGVGECVRRILVEEGIGALYASYRTTVVMNAPYTAVYFATYEAAKRGLKEVSLGSDNDERLIVHATAGAAAGSLAAALTTPLDVVKTRLQCQGVCGCDKFSSSSIGYVLGCVVKKDGYSGLMKGWIPRMMFHAPAAAICWSTYEASKTFFQHLHNDNN 311
       

Gff information


Chromosome Start End Strand Old_gene Gene Num
4 26341033 26343100 - CrPI670011_04g007750.1 Cre04g0775 495079

Annotation


Select Seq ID Length Analysis Description Start End IPR GO
Cre04g0775 311 Pfam Mitochondrial carrier protein 213 305 IPR018108 -
Cre04g0775 311 Pfam Mitochondrial carrier protein 25 111 IPR018108 -
Cre04g0775 311 Pfam Mitochondrial carrier protein 116 203 IPR018108 -
Cre04g0775 311 Gene3D Mitochondrial carrier domain 111 311 IPR023395 -
Cre04g0775 311 PANTHER MITOFERRIN-1-RELATED 20 305 - GO:0015093(PANTHER)|GO:0031966(PANTHER)|GO:0048250(PANTHER)
Cre04g0775 311 ProSiteProfiles Solute carrier (Solcar) repeat profile. 116 200 IPR018108 -
Cre04g0775 311 SUPERFAMILY Mitochondrial carrier 23 297 IPR023395 -
Cre04g0775 311 PRINTS Mitochondrial carrier protein signature 173 191 IPR002067 GO:0055085(InterPro)
Cre04g0775 311 PRINTS Mitochondrial carrier protein signature 30 43 IPR002067 GO:0055085(InterPro)
Cre04g0775 311 PRINTS Mitochondrial carrier protein signature 43 57 IPR002067 GO:0055085(InterPro)
Cre04g0775 311 PRINTS Mitochondrial carrier protein signature 131 149 IPR002067 GO:0055085(InterPro)
Cre04g0775 311 PRINTS Mitochondrial carrier protein signature 221 243 IPR002067 GO:0055085(InterPro)
Cre04g0775 311 ProSiteProfiles Solute carrier (Solcar) repeat profile. 25 109 IPR018108 -
Cre04g0775 311 ProSiteProfiles Solute carrier (Solcar) repeat profile. 212 302 IPR018108 -
       

Pathway


Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cre04g0775 K15113 - - csv:101210464 594.349
       

Dupl-types


Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cre02g2238 Cre-Chr2:36004750 Cre04g0775 Cre-Chr4:26341033 6.50E-123 dispersed
Cre04g0775 Cre-Chr4:26341033 Cre06g2428 Cre-Chr6:32164458 5.20E-29 dispersed
Cre04g0775 Cre-Chr4:26341033 Cre08g0682 Cre-Chr8:19767491 1.20E-33 transposed
       

Deco-Alignment


Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g316 . . . . . . . . . . Cma03g00330 Cma07g01076 Car03g00292 Car07g01060 Sed03g2513 . . Bhi03g02177 Tan03g0759 Cmetu08g1077 . Hepe04g0728 . . Cla04g00684 Cam04g0686 Cec04g0807 Cco04g0860 Clacu04g0732 Cmu04g0726 Cre04g0775 . . . . Lsi01g01574 Csa04g01643 Chy08g00612 . . . . . . . . . . Cmo03g00342 Cmo07g01125 . . . . . Cpe19g00268 . . . . . . . . . . . . . . . . . Cme08g02177
       

Syn-Families


Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cre03g0477 . 1 451 Chloroplast and Mitochondria Gene Families AT2G28800 61.2 2.2e-139 492.7
Cre08g1688 . 71 432 Chloroplast and Mitochondria Gene Families AT2G28800 55.0 2.1e-100 363.2
Cre08g0640 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 4.1e-120 427.9
Cre02g0613 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 1.1e-142 503.1
Cre02g2152 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 7.2e-121 430.6
Cre04g2048 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 3.6e-120 428.3
Cre04g2049 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 3.0e-119 425.2
Cre10g1333 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.6 5.2e-119 424.5
Cre03g1026 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 6.8e-119 424.1
Cre10g0841 . 5 266 Chloroplast and Mitochondria Gene Families AT3G27690 66.9 1.2e-96 350.1
Cre08g0169 . 109 312 Chloroplast and Mitochondria Gene Families AT3G27690 53.8 7.1e-52 201.4
Cre11g1792 . 3 268 Chloroplast and Mitochondria Gene Families AT3G61470 80.5 1.1e-128 456.4
Cre03g1766 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 1.3e-86 316.6
Cre06g2478 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 50.8 9.2e-64 240.7
Cre01g0412 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.1 8.1e-90 327.0
Cre04g0814 . 3 285 Chloroplast and Mitochondria Gene Families AT3G08940 82.4 8.5e-135 476.9
Cre10g2308 . 2 267 Chloroplast and Mitochondria Gene Families AT3G08940 83.9 9.4e-126 446.8
Cre11g2304 . 60 322 Chloroplast and Mitochondria Gene Families AT1G76570 81.0 1.6e-129 459.5
Cre03g1546 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.4 1.9e-136 482.3
Cre02g0613 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 3.2e-144 508.1
Cre04g2048 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 1.1e-120 429.9
Cre04g2049 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 5.4e-120 427.6
Cre02g2152 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 7.1e-120 427.2
Cre03g1026 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.2 3.5e-119 424.9
Cre10g1333 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 84.5 1.3e-118 422.9
Cre10g0841 . 7 266 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 3.8e-97 351.7
Cre08g0169 . 109 312 Chloroplast and Mitochondria Gene Families AT2G05070 54.3 4.9e-52 201.8
Cre02g0613 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.8e-125 446.0
Cre04g2048 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 6.1e-102 367.9
Cre04g2049 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 1.8e-101 366.3
Cre02g2152 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.2e-101 364.8
Cre03g1026 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 1.2e-100 363.6
Cre10g1333 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 78.4 1.2e-100 363.6
Cre10g0841 . 7 238 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 5.4e-82 301.6
Cre08g0169 . 109 296 Chloroplast and Mitochondria Gene Families AT2G05100 53.1 1.7e-43 173.7
Cre04g0814 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 8.3e-67 250.4
Cre10g2308 . 2 164 Chloroplast and Mitochondria Gene Families AT2G40100 66.7 9.9e-60 226.9
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.9e-136 482.3
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 4.2e-136 481.1
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 7.1e-136 480.3
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 2.1e-135 478.8
Cre10g1333 . 10 265 Chloroplast and Mitochondria Gene Families AT1G29930 85.3 2.3e-126 448.7
Cre02g0613 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.7e-116 414.8
Cre10g0841 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 65.2 1.0e-94 343.6
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 7.1e-136 480.3
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 1.6e-135 479.2
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 2.7e-135 478.4
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 7.9e-135 476.9
Cre10g1333 . 10 265 Chloroplast and Mitochondria Gene Families AT1G29920 85.3 3.0e-126 448.4
Cre02g0613 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.2e-116 415.6
Cre10g0841 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 65.2 1.8e-94 342.8
Cre08g0169 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 7.6e-53 204.5
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 7.1e-136 480.3
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 1.6e-135 479.2
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 2.7e-135 478.4
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 7.9e-135 476.9
Cre10g1333 . 10 265 Chloroplast and Mitochondria Gene Families AT1G29910 85.3 3.0e-126 448.4
Cre02g0613 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.2e-116 415.6
Cre10g0841 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 65.2 1.8e-94 342.8
Cre08g0169 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 7.6e-53 204.5
Cre08g0169 . 47 327 Chloroplast and Mitochondria Gene Families AT4G10340 84.7 5.5e-139 490.7
Cre04g2049 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 4.1e-57 218.8
Cre03g1026 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 6.9e-57 218.0
Cre04g2048 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.9e-57 218.0
Cre02g2152 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.2e-56 217.2
Cre10g1333 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.2e-56 217.2
Cre02g0613 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 3.2e-54 209.1
Cre10g0841 . 48 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 3.9e-52 202.2
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.2e-135 479.6
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 1.7e-134 475.7
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 3.0e-134 474.9
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 3.0e-134 474.9
Cre10g1333 . 10 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.7 4.6e-127 451.1
Cre02g0613 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 7.4e-117 417.2
Cre10g0841 . 24 266 Chloroplast and Mitochondria Gene Families AT2G34420 70.1 8.8e-94 340.5
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 8.4e-137 483.4
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 3.2e-136 481.5
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 2.1e-135 478.8
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.5 2.7e-135 478.4
Cre10g1333 . 11 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.3 6.4e-129 457.2
Cre02g0613 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 2.0e-114 409.1
Cre10g0841 . 36 266 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 8.8e-94 340.5
Cre04g0814 . 2 285 Chloroplast and Mitochondria Gene Families AT5G01530 83.5 1.3e-138 489.6
Cre10g2308 . 2 267 Chloroplast and Mitochondria Gene Families AT5G01530 86.6 1.4e-132 469.5
Cre10g0922 . 109 366 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 1.3e-142 502.7
Cre10g0922 . 62 366 Chloroplast and Mitochondria Gene Families AT3G27240 85.6 2.5e-148 521.9
Cre02g2238 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 75.3 7.5e-143 503.8
Cre04g0775 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 64.2 7.5e-111 397.5
Cre02g2238 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 76.4 3.3e-143 505.0
Cre04g0775 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.5 1.4e-117 419.9
Cre09g0527 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 1.1e-135 479.9
Cre09g1945 . 9 312 Chloroplast and Mitochondria Gene Families AT2G47490 63.5 2.1e-110 396.0
Cre09g1945 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 63.7 5.5e-123 438.0
Cre09g0527 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.6 2.1e-106 382.9
Cre03g0841 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.2 6.9e-261 896.7
Cre02g2041 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 70.1 1.9e-242 835.5
Cre02g0470 . 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.7 9.4e-226 780.0
Cre09g0071 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.3 3.6e-62 235.0
Cre06g1740 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 58.4 2.2e-51 199.1
Cre06g1740 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 59.0 2.9e-51 198.7
Cre09g0071 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 53.9 1.6e-41 166.4
Cre09g0071 . 15 187 Chloroplast and Mitochondria Gene Families AT1G72750 68.0 2.2e-62 235.7
Cre06g1740 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.2 4.1e-53 204.9
Cre05g2484 . 663 837 Chloroplast and Mitochondria Gene Families AT1G26100 69.1 4.8e-67 251.5
Cre11g1018 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 2.3e-90 328.9
Cre09g1265 . 23 230 Chloroplast and Mitochondria Gene Families AT4G25570 67.6 3.6e-82 302.0
Cre09g1856 . 2 219 Chloroplast and Mitochondria Gene Families AT1G14730 53.2 9.4e-65 243.8
Cre09g1754 . 9 356 Chloroplast and Mitochondria Gene Families AT5G14040 82.3 2.4e-169 592.0
Cre05g1439 . 10 357 Chloroplast and Mitochondria Gene Families AT5G14040 77.2 6.4e-159 557.4
Cre06g2681 . 39 340 Chloroplast and Mitochondria Gene Families AT5G14040 86.4 1.3e-154 543.1
Cre02g0667 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 51.9 3.4e-83 305.8
Cre09g1754 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 72.0 7.9e-146 513.8
Cre05g1439 . 11 363 Chloroplast and Mitochondria Gene Families AT3G48850 71.1 3.7e-143 505.0
Cre06g2681 . 10 340 Chloroplast and Mitochondria Gene Families AT3G48850 68.7 5.9e-141 497.7
Cre02g0667 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 3.0e-84 309.3
Cre02g0667 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 76.9 3.8e-133 471.5
Cre05g1439 . 64 362 Chloroplast and Mitochondria Gene Families AT2G17270 52.5 1.7e-88 323.2
Cre09g1754 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.6 5.1e-85 311.6
Cre11g0975 . 71 374 Chloroplast and Mitochondria Gene Families AT5G15640 76.5 3.7e-131 464.9
Cre05g1982 . 120 433 Chloroplast and Mitochondria Gene Families AT5G26200 64.3 2.0e-111 399.4
Cre09g0075 . 96 439 Chloroplast and Mitochondria Gene Families AT5G26200 57.8 4.1e-104 375.2
Cre09g0075 . 96 443 Chloroplast and Mitochondria Gene Families AT1G72820 76.1 1.1e-147 520.0
Cre05g1982 . 109 433 Chloroplast and Mitochondria Gene Families AT1G72820 66.5 3.9e-118 421.8
Cre09g2279 . 82 285 Chloroplast and Mitochondria Gene Families AT5G52570 52.0 5.2e-50 194.9
Cre05g1024 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.2 1.3e-69 260.0
Cre09g2279 . 69 204 Chloroplast and Mitochondria Gene Families AT4G25700 74.3 1.6e-56 216.5
Cre02g0484 . 149 327 Chloroplast and Mitochondria Gene Families AT4G03320 52.2 9.2e-57 217.6
Cre10g0843 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.0 7.3e-120 427.6
Cre06g2162 . 126 616 Chloroplast and Mitochondria Gene Families AT2G18710 85.4 4.6e-238 820.8
       

Syn-Orthogroups


Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001660 3 2 4 3 4 2 3 2 2 2 2 2 4 2 2 4 2 1 4 2 2 2 2 2 2 2 1 2 2 1 70