Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Cre11g1792 ATGGCTTCCGCTTGTGCTTCTTCCGCCATTGCGGCTGTGGCAATCTCTTCATCCAGTTCCCAGAAGAATGGGTGCCCCAAGGCTTCTAATTTCCTTACCGGCAAGAAGCTGAGGCTGAGAAACTTAACTGCCGCGGCTGCTGTTGCTCCTCGATCAGCTCCGGTATGCGCCGCAGCTGACCCCGACAGACCTCTCTGGTTCCCTGGCAGCACCCCTCCTCCATGGCTCGACGGCAGCCTTCCCGGCGACTTTGGCTTTGACCCACTTGGTCTTGCGTCTGATCCGGAGAGTCTGAGATGGAACCAGCAGGCGGAGCTGGTACACTGCCGATGGGCAATGTTGGGGGCGGCCGGAATTTTCATCCCGGAATTTTTGACAAAGATCGGAATATTGAACACTCCGTCGTGGTACACCGCCGGTGAATTGGAATACTTCACCGACACCACCACTCTGTTCATAGTGGAACTCATTTTCATTGGTTGGGCCGAGGGTAGACGGTGGGCCGACATCCTCAAACCCGGCTGCGTCAACACCGACCCGATTTTCCCTAACAACAAGCTCACCGGAACCGACGTCGGATACCCGGGTGGGCTTTGGTTCGACCCGCTCGGGTGGGGAAGCGGGTCACCCGAAAAGATCAAGGAATTAAGAACGAAAGAGATAAAGAACGGGCGATTGGCTATGTTGGCGGTGATGGGAGCTTGGTTCCAACACATTTACACCGGCACCGGTCCCATTGACAACCTCTTCGCTCACCTTGCCGATCCCGGCCACGCCACCGTCTTCGCCGCTTTCACACCAAAGTGA 807 56.63 MASACASSAIAAVAISSSSSQKNGCPKASNFLTGKKLRLRNLTAAAAVAPRSAPVCAAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPEFLTKIGILNTPSWYTAGELEYFTDTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATVFAAFTPK 268
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
11 29505023 29507282 - CrPI670011_11g017920.1 Cre11g1792 513537

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Cre11g1792 268 FunFam Chlorophyll a-b binding protein, chloroplastic 73 258 - -
Cre11g1792 268 Pfam Chlorophyll A-B binding protein 72 238 IPR022796 -
Cre11g1792 268 SUPERFAMILY Chlorophyll a-b binding protein 59 266 - -
Cre11g1792 268 PANTHER CHLOROPHYLL A/B BINDING PROTEIN 12 263 IPR001344 GO:0009416(PANTHER)|GO:0009535(PANTHER)|GO:0009765(InterPro)|GO:0009768(PANTHER)|GO:0016020(InterPro)
Cre11g1792 268 Gene3D Chlorophyll a/b binding protein domain 73 258 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Cre11g1792 K08908 - - csv:101214055 517.694
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Cre01g1548 Cre-Chr1:28670063 Cre11g1792 Cre-Chr11:29505023 4.90E-62 dispersed
Cre03g1766 Cre-Chr3:34534707 Cre11g1792 Cre-Chr11:29505023 1.20E-87 dispersed
Cre08g1539 Cre-Chr8:28010777 Cre11g1792 Cre-Chr11:29505023 4.50E-50 dispersed
Cre10g2308 Cre-Chr10:37320106 Cre11g1792 Cre-Chr11:29505023 1.50E-28 dispersed
Cre11g1792 Cre-Chr11:29505023 Cre11g2304 Cre-Chr11:34640981 4.00E-22 dispersed
Cre11g1792 Cre-Chr11:29505023 Cre06g2478 Cre-Chr6:32560685 5.20E-62 transposed
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Cre03g0477 . 1 451 Chloroplast and Mitochondria Gene Families AT2G28800 61.2 2.2e-139 492.7
Cre08g1688 . 71 432 Chloroplast and Mitochondria Gene Families AT2G28800 55.0 2.1e-100 363.2
Cre08g0640 . 3 255 Chloroplast and Mitochondria Gene Families AT1G15820 82.4 4.1e-120 427.9
Cre02g0613 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 88.7 1.1e-142 503.1
Cre02g2152 . 2 267 Chloroplast and Mitochondria Gene Families AT3G27690 78.4 7.2e-121 430.6
Cre04g2048 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.4 3.6e-120 428.3
Cre04g2049 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 3.0e-119 425.2
Cre10g1333 . 1 265 Chloroplast and Mitochondria Gene Families AT3G27690 77.6 5.2e-119 424.5
Cre03g1026 . 2 265 Chloroplast and Mitochondria Gene Families AT3G27690 76.7 6.8e-119 424.1
Cre10g0841 . 5 266 Chloroplast and Mitochondria Gene Families AT3G27690 66.9 1.2e-96 350.1
Cre08g0169 . 109 312 Chloroplast and Mitochondria Gene Families AT3G27690 53.8 7.1e-52 201.4
Cre11g1792 . 3 268 Chloroplast and Mitochondria Gene Families AT3G61470 80.5 1.1e-128 456.4
Cre03g1766 . 56 261 Chloroplast and Mitochondria Gene Families AT3G61470 66.0 1.3e-86 316.6
Cre06g2478 . 22 249 Chloroplast and Mitochondria Gene Families AT3G61470 50.8 9.2e-64 240.7
Cre01g0412 . 1 198 Chloroplast and Mitochondria Gene Families AT3G54890 81.1 8.1e-90 327.0
Cre04g0814 . 3 285 Chloroplast and Mitochondria Gene Families AT3G08940 82.4 8.5e-135 476.9
Cre10g2308 . 2 267 Chloroplast and Mitochondria Gene Families AT3G08940 83.9 9.4e-126 446.8
Cre11g2304 . 60 322 Chloroplast and Mitochondria Gene Families AT1G76570 81.0 1.6e-129 459.5
Cre03g1546 . 1 273 Chloroplast and Mitochondria Gene Families AT1G61520 86.4 1.9e-136 482.3
Cre02g0613 . 1 265 Chloroplast and Mitochondria Gene Families AT2G05070 89.4 3.2e-144 508.1
Cre04g2048 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 79.3 1.1e-120 429.9
Cre04g2049 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.6 5.4e-120 427.6
Cre02g2152 . 7 267 Chloroplast and Mitochondria Gene Families AT2G05070 78.9 7.1e-120 427.2
Cre03g1026 . 5 265 Chloroplast and Mitochondria Gene Families AT2G05070 78.2 3.5e-119 424.9
Cre10g1333 . 27 265 Chloroplast and Mitochondria Gene Families AT2G05070 84.5 1.3e-118 422.9
Cre10g0841 . 7 266 Chloroplast and Mitochondria Gene Families AT2G05070 68.0 3.8e-97 351.7
Cre08g0169 . 109 312 Chloroplast and Mitochondria Gene Families AT2G05070 54.3 4.9e-52 201.8
Cre02g0613 . 1 237 Chloroplast and Mitochondria Gene Families AT2G05100 89.5 1.8e-125 446.0
Cre04g2048 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 6.1e-102 367.9
Cre04g2049 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.4 1.8e-101 366.3
Cre02g2152 . 7 239 Chloroplast and Mitochondria Gene Families AT2G05100 76.9 5.2e-101 364.8
Cre03g1026 . 5 237 Chloroplast and Mitochondria Gene Families AT2G05100 76.5 1.2e-100 363.6
Cre10g1333 . 8 237 Chloroplast and Mitochondria Gene Families AT2G05100 78.4 1.2e-100 363.6
Cre10g0841 . 7 238 Chloroplast and Mitochondria Gene Families AT2G05100 67.6 5.4e-82 301.6
Cre08g0169 . 109 296 Chloroplast and Mitochondria Gene Families AT2G05100 53.1 1.7e-43 173.7
Cre04g0814 . 3 167 Chloroplast and Mitochondria Gene Families AT2G40100 72.8 8.3e-67 250.4
Cre10g2308 . 2 164 Chloroplast and Mitochondria Gene Families AT2G40100 66.7 9.9e-60 226.9
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 1.9e-136 482.3
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.8 4.2e-136 481.1
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 88.4 7.1e-136 480.3
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29930 87.3 2.1e-135 478.8
Cre10g1333 . 10 265 Chloroplast and Mitochondria Gene Families AT1G29930 85.3 2.3e-126 448.7
Cre02g0613 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29930 78.3 3.7e-116 414.8
Cre10g0841 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29930 65.2 1.0e-94 343.6
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29920 88.1 7.1e-136 480.3
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.4 1.6e-135 479.2
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 88.0 2.7e-135 478.4
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29920 86.9 7.9e-135 476.9
Cre10g1333 . 10 265 Chloroplast and Mitochondria Gene Families AT1G29920 85.3 3.0e-126 448.4
Cre02g0613 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29920 77.9 2.2e-116 415.6
Cre10g0841 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29920 65.2 1.8e-94 342.8
Cre08g0169 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29920 50.7 7.6e-53 204.5
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT1G29910 88.1 7.1e-136 480.3
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.4 1.6e-135 479.2
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 88.0 2.7e-135 478.4
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT1G29910 86.9 7.9e-135 476.9
Cre10g1333 . 10 265 Chloroplast and Mitochondria Gene Families AT1G29910 85.3 3.0e-126 448.4
Cre02g0613 . 3 265 Chloroplast and Mitochondria Gene Families AT1G29910 77.9 2.2e-116 415.6
Cre10g0841 . 1 266 Chloroplast and Mitochondria Gene Families AT1G29910 65.2 1.8e-94 342.8
Cre08g0169 . 92 312 Chloroplast and Mitochondria Gene Families AT1G29910 50.7 7.6e-53 204.5
Cre08g0169 . 47 327 Chloroplast and Mitochondria Gene Families AT4G10340 84.7 5.5e-139 490.7
Cre04g2049 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.9 4.1e-57 218.8
Cre03g1026 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 6.9e-57 218.0
Cre04g2048 . 37 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.5 6.9e-57 218.0
Cre02g2152 . 51 255 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.2e-56 217.2
Cre10g1333 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 54.1 1.2e-56 217.2
Cre02g0613 . 49 253 Chloroplast and Mitochondria Gene Families AT4G10340 52.6 3.2e-54 209.1
Cre10g0841 . 48 254 Chloroplast and Mitochondria Gene Families AT4G10340 54.0 3.9e-52 202.2
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34420 88.4 1.2e-135 479.6
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 88.0 1.7e-134 475.7
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.3 3.0e-134 474.9
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34420 87.6 3.0e-134 474.9
Cre10g1333 . 10 265 Chloroplast and Mitochondria Gene Families AT2G34420 85.7 4.6e-127 451.1
Cre02g0613 . 3 265 Chloroplast and Mitochondria Gene Families AT2G34420 77.2 7.4e-117 417.2
Cre10g0841 . 24 266 Chloroplast and Mitochondria Gene Families AT2G34420 70.1 8.8e-94 340.5
Cre04g2049 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 8.4e-137 483.4
Cre04g2048 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 88.3 3.2e-136 481.5
Cre02g2152 . 1 267 Chloroplast and Mitochondria Gene Families AT2G34430 88.1 2.1e-135 478.8
Cre03g1026 . 1 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.5 2.7e-135 478.4
Cre10g1333 . 11 265 Chloroplast and Mitochondria Gene Families AT2G34430 86.3 6.4e-129 457.2
Cre02g0613 . 31 265 Chloroplast and Mitochondria Gene Families AT2G34430 83.2 2.0e-114 409.1
Cre10g0841 . 36 266 Chloroplast and Mitochondria Gene Families AT2G34430 70.5 8.8e-94 340.5
Cre04g0814 . 2 285 Chloroplast and Mitochondria Gene Families AT5G01530 83.5 1.3e-138 489.6
Cre10g2308 . 2 267 Chloroplast and Mitochondria Gene Families AT5G01530 86.6 1.4e-132 469.5
Cre10g0922 . 109 366 Chloroplast and Mitochondria Gene Families AT5G40810 93.8 1.3e-142 502.7
Cre10g0922 . 62 366 Chloroplast and Mitochondria Gene Families AT3G27240 85.6 2.5e-148 521.9
Cre02g2238 . 5 327 Chloroplast and Mitochondria Gene Families AT2G30160 75.3 7.5e-143 503.8
Cre04g0775 . 9 311 Chloroplast and Mitochondria Gene Families AT2G30160 64.2 7.5e-111 397.5
Cre02g2238 . 5 323 Chloroplast and Mitochondria Gene Families AT1G07030 76.4 3.3e-143 505.0
Cre04g0775 . 5 311 Chloroplast and Mitochondria Gene Families AT1G07030 67.5 1.4e-117 419.9
Cre09g0527 . 1 305 Chloroplast and Mitochondria Gene Families AT2G47490 76.4 1.1e-135 479.9
Cre09g1945 . 9 312 Chloroplast and Mitochondria Gene Families AT2G47490 63.5 2.1e-110 396.0
Cre09g1945 . 10 364 Chloroplast and Mitochondria Gene Families AT1G25380 63.7 5.5e-123 438.0
Cre09g0527 . 11 297 Chloroplast and Mitochondria Gene Families AT1G25380 64.6 2.1e-106 382.9
Cre03g0841 . 5 584 Chloroplast and Mitochondria Gene Families AT4G21490 75.2 6.9e-261 896.7
Cre02g2041 . 1 585 Chloroplast and Mitochondria Gene Families AT4G21490 70.1 1.9e-242 835.5
Cre02g0470 . 1 574 Chloroplast and Mitochondria Gene Families AT4G21490 64.7 9.4e-226 780.0
Cre09g0071 . 5 186 Chloroplast and Mitochondria Gene Families AT1G17530 64.3 3.6e-62 235.0
Cre06g1740 . 4 179 Chloroplast and Mitochondria Gene Families AT1G17530 58.4 2.2e-51 199.1
Cre06g1740 . 12 183 Chloroplast and Mitochondria Gene Families AT3G04800 59.0 2.9e-51 198.7
Cre09g0071 . 22 186 Chloroplast and Mitochondria Gene Families AT3G04800 53.9 1.6e-41 166.4
Cre09g0071 . 15 187 Chloroplast and Mitochondria Gene Families AT1G72750 68.0 2.2e-62 235.7
Cre06g1740 . 5 183 Chloroplast and Mitochondria Gene Families AT1G72750 58.2 4.1e-53 204.9
Cre05g2484 . 663 837 Chloroplast and Mitochondria Gene Families AT1G26100 69.1 4.8e-67 251.5
Cre11g1018 . 1 226 Chloroplast and Mitochondria Gene Families AT5G38630 70.9 2.3e-90 328.9
Cre09g1265 . 23 230 Chloroplast and Mitochondria Gene Families AT4G25570 67.6 3.6e-82 302.0
Cre09g1856 . 2 219 Chloroplast and Mitochondria Gene Families AT1G14730 53.2 9.4e-65 243.8
Cre09g1754 . 9 356 Chloroplast and Mitochondria Gene Families AT5G14040 82.3 2.4e-169 592.0
Cre05g1439 . 10 357 Chloroplast and Mitochondria Gene Families AT5G14040 77.2 6.4e-159 557.4
Cre06g2681 . 39 340 Chloroplast and Mitochondria Gene Families AT5G14040 86.4 1.3e-154 543.1
Cre02g0667 . 11 298 Chloroplast and Mitochondria Gene Families AT5G14040 51.9 3.4e-83 305.8
Cre09g1754 . 8 356 Chloroplast and Mitochondria Gene Families AT3G48850 72.0 7.9e-146 513.8
Cre05g1439 . 11 363 Chloroplast and Mitochondria Gene Families AT3G48850 71.1 3.7e-143 505.0
Cre06g2681 . 10 340 Chloroplast and Mitochondria Gene Families AT3G48850 68.7 5.9e-141 497.7
Cre02g0667 . 11 297 Chloroplast and Mitochondria Gene Families AT3G48850 50.5 3.0e-84 309.3
Cre02g0667 . 14 308 Chloroplast and Mitochondria Gene Families AT2G17270 76.9 3.8e-133 471.5
Cre05g1439 . 64 362 Chloroplast and Mitochondria Gene Families AT2G17270 52.5 1.7e-88 323.2
Cre09g1754 . 62 352 Chloroplast and Mitochondria Gene Families AT2G17270 52.6 5.1e-85 311.6
Cre11g0975 . 71 374 Chloroplast and Mitochondria Gene Families AT5G15640 76.5 3.7e-131 464.9
Cre05g1982 . 120 433 Chloroplast and Mitochondria Gene Families AT5G26200 64.3 2.0e-111 399.4
Cre09g0075 . 96 439 Chloroplast and Mitochondria Gene Families AT5G26200 57.8 4.1e-104 375.2
Cre09g0075 . 96 443 Chloroplast and Mitochondria Gene Families AT1G72820 76.1 1.1e-147 520.0
Cre05g1982 . 109 433 Chloroplast and Mitochondria Gene Families AT1G72820 66.5 3.9e-118 421.8
Cre09g2279 . 82 285 Chloroplast and Mitochondria Gene Families AT5G52570 52.0 5.2e-50 194.9
Cre05g1024 . 1 219 Chloroplast and Mitochondria Gene Families AT4G25700 63.2 1.3e-69 260.0
Cre09g2279 . 69 204 Chloroplast and Mitochondria Gene Families AT4G25700 74.3 1.6e-56 216.5
Cre02g0484 . 149 327 Chloroplast and Mitochondria Gene Families AT4G03320 52.2 9.2e-57 217.6
Cre10g0843 . 72 359 Chloroplast and Mitochondria Gene Families AT5G54290 79.0 7.3e-120 427.6
Cre06g2162 . 126 616 Chloroplast and Mitochondria Gene Families AT2G18710 85.4 4.6e-238 820.8
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0001904 3 2 3 3 2 2 3 2 2 2 2 2 2 2 2 2 2 4 3 2 2 2 2 1 3 1 2 3 2 2 67