Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Csa02g00478 ATGGCGTCGAGGAACCGCACTTTGCTTTTTAAGAAATACAGGGACGCGTTGAGGAGTGTGAGGGTTCCTACCAGCTCTTCCCCTGCTTTTGCATCGCCATCGACTAGCTCAGCTGGTGGTGGCCCGGTGATTGAATTGGTTAGCTCCTCGTTGTTGCATCCGAATCGATCGTATGCTCCATTAAGTACCGAAGATCCGGGTAATTCAAGTAAGGGTGCTCTTACTGTGGGTCTTCCTCCGGCTTGGGTTGATGTATCTGAAGAAATAGCTGCAAATGTGCAGTGTGCACGAGTGAAGATGATGGAGTTGGCTAAAGCTCATGCAAAGGCTTTAATGCCTTCATTTGGTGATGGTAAAGAGGATCAACGATTAATTGAATCTCTCACGCAGGACATAACTAGTTTAATTAAGAAATCAGAGAAAGGACTCAAGAGACTCTTTGTAGCTGGACCTTCAGAAGATTCCAATATCAGAAAAAATGTTCAGCGGTCTCTTGCCACTGATCTTCAGAACCTTTCCATGGAGCTTCGCAAGAAACAATCAACTTATTTAAAGCGCCTACGGCAACAAAAAGAGGAAGGTCAAGATGGGATTGACATAGAGATGAATTTAAATGGAAATCGATCGAGAATGGAGGACGACGATTTAGAACATATGGTATTTAATGAGCATCAGATGGCTAAGCTGCGAAAGAGTGAAGCATTCACCGCAGAAAGAGAGAGAGAGATCAAACAAGTTGTAGAATCCGTGAACGAGCTTGCTCAGATCATGAAGGATCTATCTGTACTTGTCATAGACCAGGGTACCATTATTGATAGAATAGATTACAATATTCAAAATGTTGCGACGACTGTTGAAGAGGGCCTTAAGCAATTGCAGAAGGCAGAGAGAACACAGAAACAAGGAGGGATGGTGATGTGTGCGTCCATGCTCGTTATCATGTGCTTCGTCATGTTGGTTCTTTTGATCCTTAAAACCATACTATTTTGA 990 43.43 MASRNRTLLFKKYRDALRSVRVPTSSSPAFASPSTSSAGGGPVIELVSSSLLHPNRSYAPLSTEDPGNSSKGALTVGLPPAWVDVSEEIAANVQCARVKMMELAKAHAKALMPSFGDGKEDQRLIESLTQDITSLIKKSEKGLKRLFVAGPSEDSNIRKNVQRSLATDLQNLSMELRKKQSTYLKRLRQQKEEGQDGIDIEMNLNGNRSRMEDDDLEHMVFNEHQMAKLRKSEAFTAEREREIKQVVESVNELAQIMKDLSVLVIDQGTIIDRIDYNIQNVATTVEEGLKQLQKAERTQKQGGMVMCASMLVIMCFVMLVLLILKTILF* 330
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
2 3398835 3403504 + CsaV3_2G006850.1 Csa02g00478 518535

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Csa02g00478 329 PANTHER SYNTAXIN-43-LIKE 1 324 - -
Csa02g00478 329 SMART SynN_4 73 188 IPR006011 GO:0016020
Csa02g00478 329 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 233 295 IPR000727 -
Csa02g00478 329 PANTHER SYNTAXIN 1 324 IPR045242 -
Csa02g00478 329 SMART tSNARE_6 228 295 IPR000727 -
Csa02g00478 329 Pfam SNARE domain 269 321 IPR000727 -
Csa02g00478 329 Gene3D - 79 287 - -
Csa02g00478 329 SUPERFAMILY t-snare proteins 78 288 IPR010989 GO:0016020|GO:0016192
Csa02g00478 329 CDD SNARE_syntaxin16 237 294 - -
Csa02g00478 329 ProSitePatterns Syntaxin / epimorphin family signature. 239 278 IPR006012 GO:0005484|GO:0006886|GO:0016020
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Csa02g00478 K08489 STX16; syntaxin 16 - csv:101207998 611.298
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Csa02g00478 Csa-Chr2:3398835 Csa07g01878 Csa-Chr7:18758684 4.26E-140 dispersed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi14g133 . . . . . . . . . . Cma05g01087 Cma12g01045 Car05g00958 Car12g01004 . Cpe07g00878 Cpe11g00890 . . . . . . . Cla02g01497 Cam02g1577 Cec02g1601 Cco02g1642 Clacu02g1560 Cmu02g1513 Cre02g1836 Cone10ag0804 Cone3ag0826 . . . Csa02g00478 . Cme05g01576 . . Bda01g01638 . . . . Bma05g00265 Sed11g0396 Cmo05g01102 Cmo12g01056 . . . . . . Bhi06g01461 Tan08g0631 Cmetu05g1168 . Hepe08g2281 . . . . . . . . . Lsi11g00612 . Chy05g01060 .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa04g01137 . 1 310 SNARE and Associated Proteins AT1G08560 67.9 9.7e-101 363.6
Csa06g03248 . 1 303 SNARE and Associated Proteins AT2G18260 54.2 2.8e-84 308.9
Csa03g03501 . 22 279 SNARE and Associated Proteins AT3G11820 80.6 1.0e-113 406.8
Csa06g02729 . 25 284 SNARE and Associated Proteins AT3G11820 70.4 8.4e-100 360.5
Csa06g02728 . 25 284 SNARE and Associated Proteins AT3G11820 69.6 4.1e-99 358.2
Csa01g01182 . 26 281 SNARE and Associated Proteins AT3G11820 65.0 1.4e-91 333.2
Csa03g04004 . 26 285 SNARE and Associated Proteins AT3G11820 51.2 1.2e-66 250.4
Csa03g03501 . 31 279 SNARE and Associated Proteins AT3G52400 69.5 1.7e-90 329.7
Csa06g02729 . 19 284 SNARE and Associated Proteins AT3G52400 63.0 1.7e-85 313.2
Csa06g02728 . 36 284 SNARE and Associated Proteins AT3G52400 65.5 8.2e-85 310.8
Csa01g01182 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 1.6e-80 296.6
Csa01g01182 . 1 299 SNARE and Associated Proteins AT4G03330 67.2 2.0e-106 382.5
Csa03g03501 . 1 278 SNARE and Associated Proteins AT4G03330 57.2 9.9e-82 300.4
Csa06g02728 . 1 295 SNARE and Associated Proteins AT4G03330 54.5 2.7e-79 292.4
Csa06g02729 . 1 302 SNARE and Associated Proteins AT4G03330 53.3 3.0e-78 288.9
Csa03g04004 . 1 285 SNARE and Associated Proteins AT4G03330 50.2 3.1e-67 252.3
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 2.0e-127 452.2
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 1.7e-89 326.2
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G61290 57.7 1.7e-81 299.7
Csa06g02728 . 1 301 SNARE and Associated Proteins AT1G61290 54.8 8.4e-81 297.4
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G11250 77.9 3.5e-124 441.4
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 3.0e-91 332.0
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G11250 56.3 3.9e-83 305.1
Csa06g02728 . 1 284 SNARE and Associated Proteins AT1G11250 56.0 8.8e-83 303.9
Csa03g04004 . 1 309 SNARE and Associated Proteins AT3G03800 72.8 4.4e-114 407.9
Csa02g02691 . 1 305 SNARE and Associated Proteins AT3G03800 54.1 7.6e-82 300.8
Csa03g04004 . 1 203 SNARE and Associated Proteins AT5G08080 75.9 3.2e-77 285.0
Csa02g02691 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 4.2e-53 204.9
Csa03g00149 . 174 365 SNARE and Associated Proteins AT1G32270 60.1 2.7e-51 199.5
Csa05g00800 . 1 218 SNARE and Associated Proteins AT5G05760 59.0 1.8e-60 229.9
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa02g00478 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 1.5e-125 446.0
Csa07g01878 . 1 318 SNARE and Associated Proteins AT5G26980 66.8 1.3e-103 373.2
Csa07g01878 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 5.2e-105 377.9
Csa02g00478 . 1 330 SNARE and Associated Proteins AT4G02195 63.9 3.7e-103 371.7
Csa02g00478 . 1 328 SNARE and Associated Proteins AT3G05710 74.2 7.1e-126 447.2
Csa07g01878 . 1 321 SNARE and Associated Proteins AT3G05710 64.0 1.1e-99 360.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G16240 73.1 8.9e-91 330.1
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G16240 66.2 1.2e-79 293.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G79590 72.6 6.6e-90 327.4
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G79590 67.1 1.9e-81 299.3
Csa06g00630 . 56 247 SNARE and Associated Proteins AT1G28490 71.9 1.7e-66 249.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G09740 78.6 4.7e-112 401.0
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G09740 78.2 4.0e-111 397.9
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G09740 67.3 4.0e-95 344.7
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G45280 66.2 7.8e-91 330.5
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 4.8e-88 321.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G45280 64.8 1.1e-87 320.1
Csa03g03265 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 6.7e-95 344.0
Csa03g02736 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 2.0e-94 342.4
Csa06g01683 . 1 263 SNARE and Associated Proteins AT3G61450 61.0 2.2e-85 312.4
Csa06g00159 . 47 291 SNARE and Associated Proteins AT1G51740 73.7 1.3e-92 336.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0003497 3 1 2 2 1 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 4 4 2 46
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Csa02g00478 Csa_Chr02 FPKM 23.674122 23.247389 18.65489 20.900969 28.723022 24.547663 27.804146 27.482403 28.860615 29.456364