Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Csa04g01137 ATGAACGACTTAATGACCAAATCGTTCACAAGCTATGTGGATCTGAAGAAGGCAGCCATGAAGGATCTCGACCTTGAAGCCGGTCTAGAAAAGGCATCATCTGTTACCGGCGACAACGGTGACATGGGTCTGTTTCTGGAAGAGGCAGAGAAGGTGAAAACGGAGATGGGTTCGATTAGAGAGATTTTAGTTAAACTCCAACAAGCTAATGAAGAGACCAAATCTGCTCACAAACCTGAAACCCTCAAATTGCTTCGTAATGCGATCAATGTTGACATTGTCACTGTCCTCAAAAAGGCAAGATCGATCCGATCTCAGCTTGAGGAAATGGATCGTGCCAACGCTGCCAAGAAACGTCTCTCCGGCAGCAAAGAAGGCACTGCCATTTACAGGACAAGAATTGCAGTGACCAACGGGCTACGGAAGAAGCTAAAGGAATTAATGATGGAGTTTCAAAGCTTGAGGCAGAGGATGATGACGGAGTACAAAGAAACGGTTGGGCGCCGATACTTCACGGTGACGGGGGAGCATCCGGAGGAGGAGGTAATAGAGAAGATAATATCGAATGGGGGGGAGGAGTTTTTAGCAAGGGCAATAGAGGAGCATGGGCGAGGGAAGGTGGCAGAGACGGTGGTGGAGATACAGGACCGACATGGGGCCGCGAAGGAGATAGAGAAGAGCTTGTTAGAGCTACACCAAGTGTTTTTGGATATGGCAGTCATGGTTGAAGCACAAGGGGAGAAAATGGATGATATTGAACATCACGTTATGAATGCTTCGCAATATGTTATAGATGGGACCAAGGATTTGAAAACAGCAAAGGATTTGCAAAGGAATAGTAGAAAATGTTTGTGTTTTGGGATTTTGCTTTTGCTTGTGATTATTTTGGTTGTTGTTATTCCAATTGCTGTTAGTTTTGGAAGTTCTTGA 930 45.38 MNDLMTKSFTSYVDLKKAAMKDLDLEAGLEKASSVTGDNGDMGLFLEEAEKVKTEMGSIREILVKLQQANEETKSAHKPETLKLLRNAINVDIVTVLKKARSIRSQLEEMDRANAAKKRLSGSKEGTAIYRTRIAVTNGLRKKLKELMMEFQSLRQRMMTEYKETVGRRYFTVTGEHPEEEVIEKIISNGGEEFLARAIEEHGRGKVAETVVEIQDRHGAAKEIEKSLLELHQVFLDMAVMVEAQGEKMDDIEHHVMNASQYVIDGTKDLKTAKDLQRNSRKCLCFGILLLLVIILVVVIPIAVSFGSS* 310
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
4 9688071 9689626 - CsaV3_4G013350.1 Csa04g01137 526747

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Csa04g01137 309 Pfam Syntaxin 45 246 IPR006011 GO:0016020
Csa04g01137 309 PANTHER SYNTAXIN 4 302 IPR045242 -
Csa04g01137 309 CDD SNARE_syntaxin1-like 210 272 - -
Csa04g01137 309 PANTHER SYNTAXIN-RELATED PROTEIN KNOLLE 4 302 - -
Csa04g01137 309 ProSitePatterns Syntaxin / epimorphin family signature. 217 257 IPR006012 GO:0005484|GO:0006886|GO:0016020
Csa04g01137 309 SMART tSNARE_6 206 273 IPR000727 -
Csa04g01137 309 ProSiteProfiles t-SNARE coiled-coil homology domain profile. 211 273 IPR000727 -
Csa04g01137 309 CDD SynN 42 198 IPR006011 GO:0016020
Csa04g01137 309 SMART SynN_4 37 163 IPR006011 GO:0016020
Csa04g01137 309 Gene3D - 37 166 - -
Csa04g01137 309 SUPERFAMILY t-snare proteins 41 266 IPR010989 GO:0016020|GO:0016192
Csa04g01137 309 Gene3D - 206 307 - -
Csa04g01137 309 Pfam SNARE domain 248 299 IPR000727 -
Csa04g01137 309 Coils Coil 137 157 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Csa04g01137 K08486 STX1B_2_3; syntaxin 1B/2/3 - csv:101220775 580.096
       

Dupl-types

Select Gene1 Location1 Gene2 Location2 E-value Duplicated-type
Csa04g01137 Csa-Chr4:9688071 Csa06g03248 Csa-Chr6:27399246 3.39E-78 dispersed
Csa04g01137 Csa-Chr4:9688071 Csa03g03501 Csa-Chr3:31360235 3.89E-78 transposed
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi8g156 . . . . . . . . . . Cma03g00248 . Car03g00212 . Sed14g0695 Cpe10g01038 Cpe08g00962 Bhi03g02299 Tan03g0640 Cmetu08g0109 . Hepe04g0635 . . . . . . . . . Cone3ag0557 Cone10ag0552 Cone13ag0475 . Lsi01g01659 Csa04g01137 . Cme04g01796 . . . . . . . . . Cmo03g00262 Cmo07g01220 . . . . . . Bhi11g01551 . . . . . . . . . . . . . . . . Cme08g02007
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa04g01137 . 1 310 SNARE and Associated Proteins AT1G08560 67.9 9.7e-101 363.6
Csa06g03248 . 1 303 SNARE and Associated Proteins AT2G18260 54.2 2.8e-84 308.9
Csa03g03501 . 22 279 SNARE and Associated Proteins AT3G11820 80.6 1.0e-113 406.8
Csa06g02729 . 25 284 SNARE and Associated Proteins AT3G11820 70.4 8.4e-100 360.5
Csa06g02728 . 25 284 SNARE and Associated Proteins AT3G11820 69.6 4.1e-99 358.2
Csa01g01182 . 26 281 SNARE and Associated Proteins AT3G11820 65.0 1.4e-91 333.2
Csa03g04004 . 26 285 SNARE and Associated Proteins AT3G11820 51.2 1.2e-66 250.4
Csa03g03501 . 31 279 SNARE and Associated Proteins AT3G52400 69.5 1.7e-90 329.7
Csa06g02729 . 19 284 SNARE and Associated Proteins AT3G52400 63.0 1.7e-85 313.2
Csa06g02728 . 36 284 SNARE and Associated Proteins AT3G52400 65.5 8.2e-85 310.8
Csa01g01182 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 1.6e-80 296.6
Csa01g01182 . 1 299 SNARE and Associated Proteins AT4G03330 67.2 2.0e-106 382.5
Csa03g03501 . 1 278 SNARE and Associated Proteins AT4G03330 57.2 9.9e-82 300.4
Csa06g02728 . 1 295 SNARE and Associated Proteins AT4G03330 54.5 2.7e-79 292.4
Csa06g02729 . 1 302 SNARE and Associated Proteins AT4G03330 53.3 3.0e-78 288.9
Csa03g04004 . 1 285 SNARE and Associated Proteins AT4G03330 50.2 3.1e-67 252.3
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 2.0e-127 452.2
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 1.7e-89 326.2
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G61290 57.7 1.7e-81 299.7
Csa06g02728 . 1 301 SNARE and Associated Proteins AT1G61290 54.8 8.4e-81 297.4
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G11250 77.9 3.5e-124 441.4
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 3.0e-91 332.0
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G11250 56.3 3.9e-83 305.1
Csa06g02728 . 1 284 SNARE and Associated Proteins AT1G11250 56.0 8.8e-83 303.9
Csa03g04004 . 1 309 SNARE and Associated Proteins AT3G03800 72.8 4.4e-114 407.9
Csa02g02691 . 1 305 SNARE and Associated Proteins AT3G03800 54.1 7.6e-82 300.8
Csa03g04004 . 1 203 SNARE and Associated Proteins AT5G08080 75.9 3.2e-77 285.0
Csa02g02691 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 4.2e-53 204.9
Csa03g00149 . 174 365 SNARE and Associated Proteins AT1G32270 60.1 2.7e-51 199.5
Csa05g00800 . 1 218 SNARE and Associated Proteins AT5G05760 59.0 1.8e-60 229.9
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa02g00478 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 1.5e-125 446.0
Csa07g01878 . 1 318 SNARE and Associated Proteins AT5G26980 66.8 1.3e-103 373.2
Csa07g01878 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 5.2e-105 377.9
Csa02g00478 . 1 330 SNARE and Associated Proteins AT4G02195 63.9 3.7e-103 371.7
Csa02g00478 . 1 328 SNARE and Associated Proteins AT3G05710 74.2 7.1e-126 447.2
Csa07g01878 . 1 321 SNARE and Associated Proteins AT3G05710 64.0 1.1e-99 360.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G16240 73.1 8.9e-91 330.1
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G16240 66.2 1.2e-79 293.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G79590 72.6 6.6e-90 327.4
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G79590 67.1 1.9e-81 299.3
Csa06g00630 . 56 247 SNARE and Associated Proteins AT1G28490 71.9 1.7e-66 249.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G09740 78.6 4.7e-112 401.0
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G09740 78.2 4.0e-111 397.9
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G09740 67.3 4.0e-95 344.7
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G45280 66.2 7.8e-91 330.5
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 4.8e-88 321.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G45280 64.8 1.1e-87 320.1
Csa03g03265 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 6.7e-95 344.0
Csa03g02736 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 2.0e-94 342.4
Csa06g01683 . 1 263 SNARE and Associated Proteins AT3G61450 61.0 2.2e-85 312.4
Csa06g00159 . 47 291 SNARE and Associated Proteins AT1G51740 73.7 1.3e-92 336.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0010730 0 1 0 0 0 1 2 1 1 1 1 1 2 1 1 2 1 2 2 1 1 1 1 1 1 1 1 2 1 1 32
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Csa04g01137 Csa_Chr04 FPKM 6.912982 7.825508 17.13492 16.933361 15.349035 16.023304 15.519856 4.681307 5.038843 4.77815