Gene search

Sequence information

Select Gene Cds Cds_length GC_content Pep Pep_length
Csa05g00800 ATGGGTTCCGCTTATCGTGATCGGACGTCGGAATTTCGTTCACTATTGGAGACGCTGAAGAAGATTGGCGGAGCCACATCCGCCATGAATCAAGCTCAAAATGAACCATCGGCGTCTACGCCCTCCGGATCCCCGGCCTTTGCACGATCAGAATTCAGCAAAAAGGCCTCCCGCATCGGATTAGGAATCCAAGATACCTCTCAGAAGATCGTGAGGCTCGCTCAGTTGGCGAAAAGATCATCAATGTTTGATGACCCAATCAGGGAAATACAGGAAATGACTGCTTTGATTAAGAATGATATTACATCCTTGAACGTAGCTATCACAGAGTTGCAAACCATCCATAACATGGAGACAACAGAGGGGAATTCTTCAGAGGATAGAGTGGTTCATTCAACAGCTGTCTGTGATGATCTGAAGAGCAGACTTATGGGTGCTACAAAACAGCTACAAGATGTGCTAACCACAAGAACAGAGAATATCAAGGCCAATGAGAGCCGGAGGCAAATATTTTCTGCAAATGCATCTAGGGAAAGTCCTTTTCAAAATCAAGCCAAAGCTGTAACACAACCTCCACCTTGGTCAAGCAATACATCTGGAAGTGCCCAATCATCACTGTTGTCATCAAATGGAGCTCAAGTTGGGGGTCAATTGAGTCAGACGAAGGTTAGCTGTGGAGAACATGAACACCCCATCACAGCAAATGGAGATGTCGATGTTACAGCAGGTGGTTCCTAG 738 46.07 MGSAYRDRTSEFRSLLETLKKIGGATSAMNQAQNEPSASTPSGSPAFARSEFSKKASRIGLGIQDTSQKIVRLAQLAKRSSMFDDPIREIQEMTALIKNDITSLNVAITELQTIHNMETTEGNSSEDRVVHSTAVCDDLKSRLMGATKQLQDVLTTRTENIKANESRRQIFSANASRESPFQNQAKAVTQPPPWSSNTSGSAQSSLLSSNGAQVGGQLSQTKVSCGEHEHPITANGDVDVTAGGS* 246
       

Gff information

Chromosome Start End Strand Old_gene Gene Num
5 5609251 5612538 + CsaV3_5G008990.1 Csa05g00800 529187

Annotation

Select Seq ID Length Analysis Description Start End IPR GO
Csa05g00800 245 MobiDBLite consensus disorder prediction 26 47 - -
Csa05g00800 245 MobiDBLite consensus disorder prediction 26 48 - -
Csa05g00800 245 MobiDBLite consensus disorder prediction 173 245 - -
Csa05g00800 245 Pfam Syntaxin-5 N-terminal, Sly1p-binding domain 6 21 IPR021538 -
Csa05g00800 245 Gene3D - 48 229 - -
Csa05g00800 245 PANTHER SYNTAXIN-31 4 219 - -
Csa05g00800 245 PANTHER SYNTAXIN 4 219 IPR045242 -
Csa05g00800 245 SUPERFAMILY t-snare proteins 49 214 IPR010989 GO:0016020|GO:0016192
Csa05g00800 245 MobiDBLite consensus disorder prediction 173 226 - -
       

Pathway

Select Query KO Definition Second KO KEGG Genes ID GHOSTX Score
Csa05g00800 K08490 STX5; syntaxin 5 - csv:101213786 405.216
       

Deco-Alignment

Select Vvi1 Blo1 Blo2 Bda1 Bda2 Bpe1 Bpe2 Bma1 Bma2 Cmo1 Cmo2 Cma1 Cma2 Car1 Car2 Sed1 Cpe1 Cpe2 Bhi1 Tan1 Cmetu1 Lac1 Hepe1 Mch1 Lcy1 Cla1 Cam1 Cec1 Cco1 Clacu1 Cmu1 Cre1 Cone1 Cone2 Cone3 Cone4 Lsi1 Csa1 Chy1 Cme1 Blo3 Blo4 Bda3 Bda4 Bpe3 Bpe4 Bma3 Bma4 Sed2 Cmo3 Cmo4 Cma3 Cma4 Car3 Car4 Cpe3 Cpe4 Bhi2 Tan2 Cmetu2 Lac2 Hepe2 Mch2 Lcy2 Cla2 Cam2 Cec2 Cco2 Clacu2 Cmu2 Cre2 Lsi2 Csa2 Chy2 Cme2
Vvi13g19 . . . . . Bpe15g01148 . . Cmo04g00161 Cmo04g01191 Cma04g01124 Cma04g00161 Car04g00154 . . . Cpe01g00138 . . . . . . . Cla07g00385 Cam07g0410 Cec07g0462 Cco07g0418 Clacu07g0410 Cmu07g0454 Cre07g0761 . Cone5ag0210 . . . . Chy10g00436 Cme10g01057 . Blo04g00243 Bda14g00262 . . . . . . . . . . . . Cpe01g01046 . . . . . . . . . . . . . . . . Csa05g00800 . .
       

Syn-Families

Select Gene Event_type S_start S_end Function Ath_gene Identity(%) E-value Score
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa04g01137 . 1 310 SNARE and Associated Proteins AT1G08560 67.9 9.7e-101 363.6
Csa06g03248 . 1 303 SNARE and Associated Proteins AT2G18260 54.2 2.8e-84 308.9
Csa03g03501 . 22 279 SNARE and Associated Proteins AT3G11820 80.6 1.0e-113 406.8
Csa06g02729 . 25 284 SNARE and Associated Proteins AT3G11820 70.4 8.4e-100 360.5
Csa06g02728 . 25 284 SNARE and Associated Proteins AT3G11820 69.6 4.1e-99 358.2
Csa01g01182 . 26 281 SNARE and Associated Proteins AT3G11820 65.0 1.4e-91 333.2
Csa03g04004 . 26 285 SNARE and Associated Proteins AT3G11820 51.2 1.2e-66 250.4
Csa03g03501 . 31 279 SNARE and Associated Proteins AT3G52400 69.5 1.7e-90 329.7
Csa06g02729 . 19 284 SNARE and Associated Proteins AT3G52400 63.0 1.7e-85 313.2
Csa06g02728 . 36 284 SNARE and Associated Proteins AT3G52400 65.5 8.2e-85 310.8
Csa01g01182 . 1 281 SNARE and Associated Proteins AT3G52400 56.0 1.6e-80 296.6
Csa01g01182 . 1 299 SNARE and Associated Proteins AT4G03330 67.2 2.0e-106 382.5
Csa03g03501 . 1 278 SNARE and Associated Proteins AT4G03330 57.2 9.9e-82 300.4
Csa06g02728 . 1 295 SNARE and Associated Proteins AT4G03330 54.5 2.7e-79 292.4
Csa06g02729 . 1 302 SNARE and Associated Proteins AT4G03330 53.3 3.0e-78 288.9
Csa03g04004 . 1 285 SNARE and Associated Proteins AT4G03330 50.2 3.1e-67 252.3
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G61290 79.3 2.0e-127 452.2
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G61290 62.3 1.7e-89 326.2
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G61290 57.7 1.7e-81 299.7
Csa06g02728 . 1 301 SNARE and Associated Proteins AT1G61290 54.8 8.4e-81 297.4
Csa01g01182 . 1 299 SNARE and Associated Proteins AT1G11250 77.9 3.5e-124 441.4
Csa03g03501 . 1 279 SNARE and Associated Proteins AT1G11250 62.4 3.0e-91 332.0
Csa06g02729 . 1 284 SNARE and Associated Proteins AT1G11250 56.3 3.9e-83 305.1
Csa06g02728 . 1 284 SNARE and Associated Proteins AT1G11250 56.0 8.8e-83 303.9
Csa03g04004 . 1 309 SNARE and Associated Proteins AT3G03800 72.8 4.4e-114 407.9
Csa02g02691 . 1 305 SNARE and Associated Proteins AT3G03800 54.1 7.6e-82 300.8
Csa03g04004 . 1 203 SNARE and Associated Proteins AT5G08080 75.9 3.2e-77 285.0
Csa02g02691 . 1 204 SNARE and Associated Proteins AT5G08080 58.8 4.2e-53 204.9
Csa03g00149 . 174 365 SNARE and Associated Proteins AT1G32270 60.1 2.7e-51 199.5
Csa05g00800 . 1 218 SNARE and Associated Proteins AT5G05760 59.0 1.8e-60 229.9
Csa02g02340 . 479 810 SNARE and Associated Proteins AT3G24350 64.6 2.1e-102 369.4
Csa02g00478 . 1 327 SNARE and Associated Proteins AT5G26980 75.8 1.5e-125 446.0
Csa07g01878 . 1 318 SNARE and Associated Proteins AT5G26980 66.8 1.3e-103 373.2
Csa07g01878 . 1 318 SNARE and Associated Proteins AT4G02195 66.8 5.2e-105 377.9
Csa02g00478 . 1 330 SNARE and Associated Proteins AT4G02195 63.9 3.7e-103 371.7
Csa02g00478 . 1 328 SNARE and Associated Proteins AT3G05710 74.2 7.1e-126 447.2
Csa07g01878 . 1 321 SNARE and Associated Proteins AT3G05710 64.0 1.1e-99 360.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G16240 73.1 8.9e-91 330.1
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G16240 66.2 1.2e-79 293.1
Csa07g01013 . 1 234 SNARE and Associated Proteins AT1G79590 72.6 6.6e-90 327.4
Csa03g00456 . 1 234 SNARE and Associated Proteins AT1G79590 67.1 1.9e-81 299.3
Csa06g00630 . 56 247 SNARE and Associated Proteins AT1G28490 71.9 1.7e-66 249.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G09740 78.6 4.7e-112 401.0
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G09740 78.2 4.0e-111 397.9
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G09740 67.3 4.0e-95 344.7
Csa06g01683 . 1 267 SNARE and Associated Proteins AT3G45280 66.2 7.8e-91 330.5
Csa03g02736 . 1 264 SNARE and Associated Proteins AT3G45280 65.2 4.8e-88 321.2
Csa03g03265 . 1 264 SNARE and Associated Proteins AT3G45280 64.8 1.1e-87 320.1
Csa03g03265 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 6.7e-95 344.0
Csa03g02736 . 1 261 SNARE and Associated Proteins AT3G61450 68.2 2.0e-94 342.4
Csa06g01683 . 1 263 SNARE and Associated Proteins AT3G61450 61.0 2.2e-85 312.4
Csa06g00159 . 47 291 SNARE and Associated Proteins AT1G51740 73.7 1.3e-92 336.3
       

Syn-Orthogroups

Select Orthogroup Bda Bhi Blo Bma Bpe Cam Car Cco Cec Chy Cla Clacu Cma Cme Cmetu Cmo Cmu Cone Cpe Cre Csa HCH Hepe Lac Lcy Lsi Mch Sed Tan Vvi Total
OG0006940 1 1 1 1 1 1 2 1 1 1 1 1 2 1 1 2 1 1 2 1 1 1 1 1 1 1 1 3 1 1 36
       

Transcriptome

Select Gene Chr Type da1 da2 da3 da4 da5 da6 da7 da8 da9 da10
Csa05g00800 Csa_Chr05 FPKM 6.949074 5.776332 0.848715 2.634678 7.078012 4.336042 6.458844 1.060975 4.95508 1.304285